POU4F3 Antibody - Azide and BSA Free

Western Blot: POU4F3 Antibody [H00005459-B01P] - Analysis of POU4F3 expression in transfected 293T cell line by POU4F3 polyclonal antibody. Lane 1: POU4F3 transfected lysate(37.18 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

POU4F3 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: POU4F3 (NP_002691.1, 1 a.a. - 338 a.a.) full-length human protein. MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
• Specificity: Reacts with POU class 4 homeobox 3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: POU4F3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POU4F3 Antibody - Azide and BSA Free

• brain-3C
• Brain-specific homeobox/POU domain protein 3C
• BRN3.1
• Brn-3C
• BRN3Cbrn-3C
• DFNA15
• MGC138412
• POU class 4 homeobox 3
• POU domain class 4, transcription factor 3
• POU domain, class 4, transcription factor 3

Background

This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU4F3
• Entrez:
  • 5459(Human)
• Uniprot:
  • NP_002691.1(Human)