POU2F3 Recombinant Protein Antigen

Images

 
There are currently no images for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POU2F3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POU2F3

Source: E.coli

Amino Acid Sequence: PVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POU2F3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21362. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POU2F3 Recombinant Protein Antigen

  • Epoc-1
  • MGC126698
  • OCT11
  • OCT-11
  • OCT11FLJ40063
  • Octamer-binding protein 11
  • Octamer-binding transcription factor 11
  • OTF11
  • OTF-11
  • PLA1
  • PLA-1
  • POU class 2 homeobox 3
  • POU domain class 2, transcription factor 3
  • POU domain, class 2, transcription factor 3
  • POU transcription factor
  • POU2F3
  • Skn-1a
  • Transcription factor PLA-1
  • Transcription factor Skn-1

Background

POU2F3, also referred to as POU domain, class 2, transcription factor 3, is a transcription factor that belongs to the POU protein family. POU2F3 has a 436 amino acid long isoform, a 438 amino acid long isoform, and a 432 amino acid long isoform, all three of which are approximately 47kDa. POU2F3 is highly expressed in keratinocytes and the epidermis. Current research surrounding POU2F3 has shown possible interactions with diseases and disorders such as atherosclerosis, bipolar disorder, herpes, cervical cancer, breast cancer, and neuroendocrine tumors. POU2F3 has also been shown to interact with Bcl6, Ubiquitin and KAT3A/CBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: IP, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75734
Species: Hu
Applications: ELISA, IHC,  IHC-P, PA, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-61736
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC,  IHC-P, WB
AF6790
Species: Hu
Applications: IHC, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-21362PEP
Species: Hu
Applications: AC

Publications for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP) (0)

There are no publications for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP) (0)

There are no reviews for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POU2F3 Recombinant Protein Antigen (NBP3-21362PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU2F3 Products

Blogs on POU2F3

There are no specific blogs for POU2F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POU2F3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POU2F3