Polycystin 2 Antibody (1G3)

Images

 
Sandwich ELISA: Polycystin 2 Antibody (1G3) [H00005311-M02] - Detection limit for recombinant GST tagged PKD2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Polycystin 2 Antibody (1G3) Summary

Immunogen
PKD2 (NP_000288 261 a.a. - 360 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Polycystin 2 Antibody (1G3)

  • APKD2
  • Autosomal dominant polycystic kidney disease type II protein
  • MGC138466
  • MGC138468
  • PC2
  • Pc-2
  • PKD4
  • polycystic kidney disease 2 (autosomal dominant)
  • Polycystic kidney disease 2 protein
  • polycystin-2
  • polycystwin
  • R48321
  • transient receptor potential cation channel, subfamily P, member 2
  • TRPP2

Background

FUNCTION: Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis. SUBUNIT: Interacts with PKD1. PKD1 requires the presence of PKD2 for stable expression. Interacts with CD2AP. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in mesenchymally derived structures in the developing embryo at day 12.5. In adult, mostly expressed in kidney.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow

Publications for Polycystin 2 Antibody (H00005311-M02) (0)

There are no publications for Polycystin 2 Antibody (H00005311-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polycystin 2 Antibody (H00005311-M02) (0)

There are no reviews for Polycystin 2 Antibody (H00005311-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Polycystin 2 Antibody (H00005311-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Polycystin 2 Products

Bioinformatics Tool for Polycystin 2 Antibody (H00005311-M02)

Discover related pathways, diseases and genes to Polycystin 2 Antibody (H00005311-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polycystin 2 Antibody (H00005311-M02)

Discover more about diseases related to Polycystin 2 Antibody (H00005311-M02).
 

Pathways for Polycystin 2 Antibody (H00005311-M02)

View related products by pathway.

PTMs for Polycystin 2 Antibody (H00005311-M02)

Learn more about PTMs related to Polycystin 2 Antibody (H00005311-M02).
 

Research Areas for Polycystin 2 Antibody (H00005311-M02)

Find related products by research area.

Blogs on Polycystin 2

There are no specific blogs for Polycystin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Polycystin 2 Antibody (1G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD2
Uniprot