POLR3H Antibody - BSA Free

Western Blot: POLR3H Antibody [NBP2-13787] - Analysis in control (vector only transfected HEK293T lysate) and POLR3H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: POLR3H Antibody [NBP2-13787] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLR3H Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POLR3H Antibody - BSA Free (NBP2-13787) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR3H
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  POLR3H Protein (NBP2-13787PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POLR3H Antibody - BSA Free

• DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide
• DNA-directed RNA polymerase III subunit H
• DNA-directed RNA polymerase III subunit RPC8
• KIAA1665MGC29654
• MGC111097
• polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
• RNA nucleotidyltransferase (DNA-directed)
• RNA polymerase III subunit 22.9 kDa subunit
• RNA polymerase III subunit C8
• RNA polymerase III subunit RPC8
• RPC8RPC22.9

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleosidetriphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Actsas nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves astemplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encodedRNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR3H