We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

POLR3H Antibody - BSA Free

Images

 
Western Blot: POLR3H Antibody [NBP2-13787] - Analysis in control (vector only transfected HEK293T lysate) and POLR3H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: POLR3H Antibody [NBP2-13787] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.
ChIP-Exo-Seq composite graph for Anti-POLR3H tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

POLR3H Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3H
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
POLR3H Protein (NBP2-13787PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POLR3H Antibody - BSA Free

  • DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide
  • DNA-directed RNA polymerase III subunit H
  • DNA-directed RNA polymerase III subunit RPC8
  • KIAA1665MGC29654
  • MGC111097
  • polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
  • RNA nucleotidyltransferase (DNA-directed)
  • RNA polymerase III subunit 22.9 kDa subunit
  • RNA polymerase III subunit C8
  • RNA polymerase III subunit RPC8
  • RPC8RPC22.9

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleosidetriphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Actsas nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves astemplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encodedRNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84621
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-84628
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
H00080279-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-49530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05584
Species: Mu, Rt
Applications: WB
NBP2-13787
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ChIP

Publications for POLR3H Antibody (NBP2-13787) (0)

There are no publications for POLR3H Antibody (NBP2-13787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3H Antibody (NBP2-13787) (0)

There are no reviews for POLR3H Antibody (NBP2-13787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR3H Antibody (NBP2-13787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR3H Products

Research Areas for POLR3H Antibody (NBP2-13787)

Find related products by research area.

Blogs on POLR3H

There are no specific blogs for POLR3H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3H Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3H