POLR3H Antibody

Images

 
Western Blot: POLR3H Antibody [NBP1-53025] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR3H Antibody Summary

Immunogen
Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
Specificity
This product is specific to Subunit or Isofrom: RPC8.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLR3H and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POLR3H Antibody

  • DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide
  • DNA-directed RNA polymerase III subunit H
  • DNA-directed RNA polymerase III subunit RPC8
  • KIAA1665MGC29654
  • MGC111097
  • polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
  • RNA nucleotidyltransferase (DNA-directed)
  • RNA polymerase III subunit 22.9 kDa subunit
  • RNA polymerase III subunit C8
  • RNA polymerase III subunit RPC8
  • RPC8RPC22.9

Background

POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49530
Species: Hu
Applications: WB, ICC/IF, IHC
H00005545-R02
Species: Hu
NBP1-53025
Species: Hu
Applications: WB

Publications for POLR3H Antibody (NBP1-53025) (0)

There are no publications for POLR3H Antibody (NBP1-53025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3H Antibody (NBP1-53025) (0)

There are no reviews for POLR3H Antibody (NBP1-53025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3H Antibody (NBP1-53025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR3H Products

Bioinformatics Tool for POLR3H Antibody (NBP1-53025)

Discover related pathways, diseases and genes to POLR3H Antibody (NBP1-53025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on POLR3H

There are no specific blogs for POLR3H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3H
Uniprot