PMCA4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PMCA4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP2B4.
  
  

  Source: E. coli

  Amino Acid Sequence: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ATP2B4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31984.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PMCA4 Recombinant Protein Antigen

• ATP2B2plasma membrane calcium ATPase
• ATPase, Ca++ transporting, plasma membrane 4
• DKFZp686G08106
• DKFZp686M088
• EC 3.6.3
• EC 3.6.3.8
• Matrix-remodeling-associated protein 1
• matrix-remodelling associated 1
• MXRA1
• Plasma membrane calcium ATPase isoform 4
• Plasma membrane calcium pump isoform 4
• plasma membrane calcium pump
• plasma membrane calcium-transporting ATPase 4
• PMCA4b
• PMCA4PMCA4x
• sarcolemmal calcium pump

Background

The protein encoded by the PMCA4 gene belongs to the family of P-type primary ion transport ATPases characterized by theformation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ionsfrom eukaryotic cells against very large concentration gradients and play a critical role in intracellular calciumhomeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and thediversity of these enzymes is further increased by alternative splicing of transcripts. The expression of differentisoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting thatthese pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes theplasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms havebeen identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ATP2B4