PMCA4 Antibody (2G8) - Azide and BSA Free

Western Blot: PMCA4 Antibody (2G8) [H00000493-M07] - PMCA4b inhibition abrogates renalase peptide mediated MAPK signaling and cytoprotection. Endogenous expression of PMCA4b in WT and renalase KO mice, western immunoblot using an anti-renalase monoclonal antibody; 10 ug protein loaded in each lane. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0122932), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: PMCA4 Antibody (2G8) [H00000493-M07] - Identification of plasma membrane calcium ATPase isoform PMCA4b as a renalase binding protein. Co-immunolocalization of PMCA4b and renalase in HK-2 cells, images acquired using a Zeiss laser scanning confocal microscope, scale bar = 9 um; arrow = plasma membrane. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0122932), licensed under a CC-BY license.

Western Blot: PMCA4 Antibody (2G8) [H00000493-M07] - Identification of plasma membrane calcium ATPase isoform PMCA4b as a renalase binding protein. Co-Immunoprecipitation of PMCA4b and renalase from HK-2 cell lysates; renalase-Ab-beads = renalase antibody coated beads; PMCA4b-Ab-beads = PMCA4b antibody coated beads. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0122932), licensed under a CC-BY license.

Western Blot: PMCA4 Antibody (2G8) [H00000493-M07] - PMCA4b inhibition abrogates renalase peptide mediated MAPK signaling and cytoprotection. siRNA mediated inhibition of PMCA4b expression downregulates RP-220 mediated MAPK signaling; left panel: RP-220 mediated ERK and p38 activation in HK-2 cells transfected with non-targeting siRNA, p = phosphorylated, representative immunoblot; middle panel: Inhibition of RP-220 mediated ERK and p38 activation in HK-2 cells transfected with PMCA4b siRNA, representative blot; right panel: quantification of phosphorylated ERK (p-ERK), signals normalized to glyceraldehyde 3-phosphate dehydrogenase (GAPDH) loading control; n = 3, * = P<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0122932), licensed under a CC-BY license.

Western Blot: PMCA4 Antibody (2G8) [H00000493-M07] - PMCA4b inhibition abrogates renalase peptide mediated MAPK signaling and cytoprotection. Lack of effect of siRNA mediated inhibition of PMCA4b expression on epidermal growth factor (EGF)- mediated MAPK signaling; left panel: EGF (100 ng/ml) mediated ERK, p38 activation and c-Jun N-Terminal Kinase (JNK) in HK-2 cells transfected with non-targeting siRNA, p = phosphorylated, representative blot; right panel: EGF-mediated ERK, p38 and JNK activation in HK-2 cells unaffected by transfection with PMCA4b siRNA and downregulation of PMCA4b expression; representative blot (n = 3). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0122932), licensed under a CC-BY license.

Sandwich ELISA: PMCA4 Antibody (2G8) [H00000493-M07] - Detection limit for recombinant GST tagged ATP2B4 is 1 ng/ml as a capture antibody.

Western Blot: PMCA4 Antibody (2G8) [H00000493-M07] - Identification of plasma membrane calcium ATPase isoform PMCA4b as a renalase binding protein.A, HK-2 cells incubated with either labeled RP-Scr220 or RP-220, biotin-labeled proteins purified using streptavidin column, separated by SDS-PAGE & visualized by western blot using streptavidin-HRP; * = regions evaluated by mass spectrometry in samples labeled with either RP-Scr220 or RP-220; # = RP-220 band containing the plasma membrane calcium ATPase isoform PMCA4b. B, Endogenous expression of PMCA4b in HK-2 cells, western immunoblot using isoform specific monoclonal; CCL-119: human leukemic cell line; thyroid tumor = human thyroid tumor cell line (ATCC, CRL-1803) 10 μg protein loaded in each lane. C, co-immunolocalization of PMCA4b & renalase in HK-2 cells, images acquired using a Zeiss laser scanning confocal microscope, scale bar = 9 μm; arrow = plasma membrane. D, Co-Immunoprecipitation of PMCA4b & renalase from HK-2 cell lysates; renalase-Ab-beads = renalase antibody coated beads; PMCA4b-Ab-beads = PMCA4b antibody coated beads. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25906147), licensed under a CC0-1.0 license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PMCA4 Antibody (2G8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
• Specificity: This product is specific for Human ATP2B4 monoclonal antibody (M07), clone 2G8 [Gene ID: 493].
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP2B4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PMCA4 Antibody (2G8) - Azide and BSA Free

• ATP2B2plasma membrane calcium ATPase
• ATPase, Ca++ transporting, plasma membrane 4
• DKFZp686G08106
• DKFZp686M088
• EC 3.6.3
• EC 3.6.3.8
• Matrix-remodeling-associated protein 1
• matrix-remodelling associated 1
• MXRA1
• Plasma membrane calcium ATPase isoform 4
• Plasma membrane calcium pump isoform 4
• plasma membrane calcium pump
• plasma membrane calcium-transporting ATPase 4
• PMCA4b
• PMCA4PMCA4x
• sarcolemmal calcium pump

Background

The protein encoded by the PMCA4 gene belongs to the family of P-type primary ion transport ATPases characterized by theformation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ionsfrom eukaryotic cells against very large concentration gradients and play a critical role in intracellular calciumhomeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and thediversity of these enzymes is further increased by alternative splicing of transcripts. The expression of differentisoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting thatthese pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes theplasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms havebeen identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMCA4 Antibody (H00000493-M07)(1)

Publication using H00000493-M07

• Wang L, Velazquez H, Chang J et al. Identification of a receptor for extracellular renalase PLoS ONE 2015-04-24 [PMID: 25906147] (WB, Human)

Bioinformatics

• Gene Symbol: ATP2B4
• Uniprot:
  • NP_001675(Human)