Recombinant Human PLSCR4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLSCR4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 56-155 of Human PLSCR4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LPMGYYSPQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLSCR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLSCR4 Protein

  • Ca(2+)-dependent phospholipid scramblase 4
  • cell growth inhibiting protein 43
  • Cell growth-inhibiting gene 43 protein
  • phospholipid scramblase 4
  • PL scramblase 4
  • TRA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57507
Species: Hu
Applications: ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-52866
Species: Hu, Mu
Applications: WB
NBP1-32588
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-56629
Species: Hu
Applications: WB
NBP2-45466
Species: Hu
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA

Publications for PLSCR4 Partial Recombinant Protein (H00057088-Q01) (0)

There are no publications for PLSCR4 Partial Recombinant Protein (H00057088-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLSCR4 Partial Recombinant Protein (H00057088-Q01) (0)

There are no reviews for PLSCR4 Partial Recombinant Protein (H00057088-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLSCR4 Partial Recombinant Protein (H00057088-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLSCR4 Products

Bioinformatics Tool for PLSCR4 Partial Recombinant Protein (H00057088-Q01)

Discover related pathways, diseases and genes to PLSCR4 Partial Recombinant Protein (H00057088-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLSCR4 Partial Recombinant Protein (H00057088-Q01)

Discover more about diseases related to PLSCR4 Partial Recombinant Protein (H00057088-Q01).
 

Pathways for PLSCR4 Partial Recombinant Protein (H00057088-Q01)

View related products by pathway.

Blogs on PLSCR4

There are no specific blogs for PLSCR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
PLSCR4 Antibody
NBP1-86165

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLSCR4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLSCR4