PLK5 Antibody


Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry: PLK5 Antibody [NBP2-48630] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining in human testis and tonsil tissues using anti-PLK5 antibody. Corresponding PLK5 RNA-seq data are presented for the same more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PLK5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
Specificity of human PLK5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLK5 Recombinant Protein Antigen (NBP2-48630PEP)

Reactivity Notes

Mouse (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLK5 Antibody

  • MGC118807
  • MGC118808
  • PLK5P
  • polo-like kinase 5
  • polo-like kinase 5, pseudogene
  • SgK384ps


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Rt

Publications for PLK5 Antibody (NBP2-48630) (0)

There are no publications for PLK5 Antibody (NBP2-48630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK5 Antibody (NBP2-48630) (0)

There are no reviews for PLK5 Antibody (NBP2-48630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLK5 Antibody (NBP2-48630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP2-48630

Bioinformatics Tool for PLK5 Antibody (NBP2-48630)

Discover related pathways, diseases and genes to PLK5 Antibody (NBP2-48630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK5 Antibody (NBP2-48630)

Discover more about diseases related to PLK5 Antibody (NBP2-48630).

Pathways for PLK5 Antibody (NBP2-48630)

View related products by pathway.

PTMs for PLK5 Antibody (NBP2-48630)

Learn more about PTMs related to PLK5 Antibody (NBP2-48630).

Research Areas for PLK5 Antibody (NBP2-48630)

Find related products by research area.

Blogs on PLK5

There are no specific blogs for PLK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLK5 Antibody and receive a gift card or discount.


Gene Symbol PLK5