PLK5 Antibody

Images

 
Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry: PLK5 Antibody [NBP2-48630] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PLK5 Antibody [NBP2-48630] - Staining in human testis and tonsil tissues using anti-PLK5 antibody. Corresponding PLK5 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLK5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
Specificity
Specificity of human PLK5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLK5 Recombinant Protein Antigen (NBP2-48630PEP)

Reactivity Notes

Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLK5 Antibody

  • MGC118807
  • MGC118808
  • PLK5P
  • polo-like kinase 5
  • polo-like kinase 5, pseudogene
  • SgK384ps

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-894
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-64664
Species: Hu
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
7815-NG/CF
Species: Rt

Publications for PLK5 Antibody (NBP2-48630) (0)

There are no publications for PLK5 Antibody (NBP2-48630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK5 Antibody (NBP2-48630) (0)

There are no reviews for PLK5 Antibody (NBP2-48630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLK5 Antibody (NBP2-48630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-48630

Bioinformatics Tool for PLK5 Antibody (NBP2-48630)

Discover related pathways, diseases and genes to PLK5 Antibody (NBP2-48630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK5 Antibody (NBP2-48630)

Discover more about diseases related to PLK5 Antibody (NBP2-48630).
 

Pathways for PLK5 Antibody (NBP2-48630)

View related products by pathway.

PTMs for PLK5 Antibody (NBP2-48630)

Learn more about PTMs related to PLK5 Antibody (NBP2-48630).
 

Research Areas for PLK5 Antibody (NBP2-48630)

Find related products by research area.

Blogs on PLK5

There are no specific blogs for PLK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLK5