PLEKHB2 Antibody


Western Blot: PLEKHB2 Antibody [NBP2-68994] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry: PLEKHB2 Antibody [NBP2-68994] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PLEKHB2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
PLEKHB2 Recombinant Protein Antigen (NBP2-68994PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for PLEKHB2 Antibody

  • evectin-2
  • EVT2FLJ20783
  • FLJ23679
  • FLJ30436
  • PH domain-containing family B member 2
  • pleckstrin homology domain containing, family B (evectins) member 2
  • pleckstrin homology domain-containing family B member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Rt
Applications: PEP-ELISA, WB
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PLEKHB2 Antibody (NBP2-68994) (0)

There are no publications for PLEKHB2 Antibody (NBP2-68994).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHB2 Antibody (NBP2-68994) (0)

There are no reviews for PLEKHB2 Antibody (NBP2-68994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHB2 Antibody (NBP2-68994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLEKHB2 Products

Bioinformatics Tool for PLEKHB2 Antibody (NBP2-68994)

Discover related pathways, diseases and genes to PLEKHB2 Antibody (NBP2-68994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHB2 Antibody (NBP2-68994)

Discover more about diseases related to PLEKHB2 Antibody (NBP2-68994).

Pathways for PLEKHB2 Antibody (NBP2-68994)

View related products by pathway.

Research Areas for PLEKHB2 Antibody (NBP2-68994)

Find related products by research area.

Blogs on PLEKHB2

There are no specific blogs for PLEKHB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLEKHB2 Antibody and receive a gift card or discount.


Gene Symbol PLEKHB2