Recombinant Human PLEKHA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLEKHA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 600-699 of Human PLEKHA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RNQECGRPFPRPTSPRLLTLGRTLSPARRQPDVEQRPVVGHSGAQKWLRSSGSWSSPRNTTPYLPTSEGHRERVLSLSQALATEASQWHRMMTGGNLDSQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
PLEKHA4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLEKHA4 Protein

  • PEPP-1
  • PEPP1phosphoinositol 3-phosphate binding protein-1
  • PH domain-containing family A member 4
  • phosphoinositol 3-phosphate-binding PH domain protein 1
  • Phosphoinositol 3-phosphate-binding protein 1
  • pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 4
  • pleckstrin homology domain-containing family A member 4
  • pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 4

Background

PLEKHA4 - pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00084528-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-23727
Species: Hu, Rt
Applications: IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-84612
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-13973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00768
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86967
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLEKHA4 Partial Recombinant Protein (H00057664-Q01) (0)

There are no publications for PLEKHA4 Partial Recombinant Protein (H00057664-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHA4 Partial Recombinant Protein (H00057664-Q01) (0)

There are no reviews for PLEKHA4 Partial Recombinant Protein (H00057664-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHA4 Partial Recombinant Protein (H00057664-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLEKHA4 Products

Bioinformatics Tool for PLEKHA4 Partial Recombinant Protein (H00057664-Q01)

Discover related pathways, diseases and genes to PLEKHA4 Partial Recombinant Protein (H00057664-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLEKHA4

There are no specific blogs for PLEKHA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLEKHA4 Antibody
NBP2-47331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLEKHA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA4