PLD1 Antibody (2F3)

Images

 
Western Blot: PLD1 Antibody (2F3) [H00005337-M01] - Analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody (M01), clone 2F3.Lane 1: PLD1 transfected lysate(124.2 KDa).Lane 2: ...read more
Sandwich ELISA: PLD1 Antibody (2F3) [H00005337-M01] - Detection limit for recombinant GST tagged PLD1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLD1 Antibody (2F3) Summary

Immunogen
PLD1 (NP_002653 965 a.a. - 1074 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Specificity
PLD1 - phospholipase D1, phophatidylcholine-specific
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publication using H00005337-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLD1 Antibody (2F3)

  • Choline phosphatase 1
  • EC 3.1.4.4
  • hPLD1
  • Phosphatidylcholine-hydrolyzing phospholipase D1
  • phospholipase D1
  • phospholipase D1, phophatidylcholine-specific
  • phospholipase D1, phosphatidylcholine-specific
  • PLD 1
  • PLD1

Background

Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. A range of agonists acting through G protein-coupled receptors and receptor tyrosine kinases stimulate this hydrolysis. PC-specific PLD activity has been implicated in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis (Hammond et al., 1995 [PubMed 8530346]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005337-M01
Species: Hu
Applications: WB, ELISA

Publications for PLD1 Antibody (H00005337-M01)(1)

Reviews for PLD1 Antibody (H00005337-M01) (0)

There are no reviews for PLD1 Antibody (H00005337-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLD1 Antibody (H00005337-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLD1 Products

Bioinformatics Tool for PLD1 Antibody (H00005337-M01)

Discover related pathways, diseases and genes to PLD1 Antibody (H00005337-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLD1 Antibody (H00005337-M01)

Discover more about diseases related to PLD1 Antibody (H00005337-M01).
 

Pathways for PLD1 Antibody (H00005337-M01)

View related products by pathway.

PTMs for PLD1 Antibody (H00005337-M01)

Learn more about PTMs related to PLD1 Antibody (H00005337-M01).
 

Research Areas for PLD1 Antibody (H00005337-M01)

Find related products by research area.

Blogs on PLD1

There are no specific blogs for PLD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLD1 Antibody (2F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLD1
Entrez
OMIM
Uniprot