Recombinant Human PLCXD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLCXD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 224-323 of Human PLCXD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLCXD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLCXD1 Protein

  • FLJ11323
  • phosphatidylinositol-specific phospholipase C, X domain containing 1
  • PI-PLC X domain-containing protein 1

Background

PLCXD1 - phosphatidylinositol-specific phospholipase C, X domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6117
Species: Hu
Applications: WB, IHC
NBP2-32046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP2-14066
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF5735
Species: Hu
Applications: WB
NBP1-85219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLCXD1 Partial Recombinant Protein (H00055344-Q01) (0)

There are no publications for PLCXD1 Partial Recombinant Protein (H00055344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCXD1 Partial Recombinant Protein (H00055344-Q01) (0)

There are no reviews for PLCXD1 Partial Recombinant Protein (H00055344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLCXD1 Partial Recombinant Protein (H00055344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLCXD1 Products

Bioinformatics Tool for PLCXD1 Partial Recombinant Protein (H00055344-Q01)

Discover related pathways, diseases and genes to PLCXD1 Partial Recombinant Protein (H00055344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCXD1 Partial Recombinant Protein (H00055344-Q01)

Discover more about diseases related to PLCXD1 Partial Recombinant Protein (H00055344-Q01).
 

Pathways for PLCXD1 Partial Recombinant Protein (H00055344-Q01)

View related products by pathway.

Blogs on PLCXD1

There are no specific blogs for PLCXD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLCXD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCXD1