PLA2G4C Recombinant Protein Antigen

Images

 
There are currently no images for PLA2G4C Protein (NBP1-85480PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLA2G4C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2G4C.

Source: E. coli

Amino Acid Sequence: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLA2G4C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85480.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLA2G4C Recombinant Protein Antigen

  • cPLA2-gamma
  • cytosolic phospholipase A2 gamma
  • DKFZp586C0423
  • EC 3.1.1.4
  • FLJ42247
  • FLJ44164
  • Phospholipase A2 group IVC
  • phospholipase A2, group IVC (cytosolic, calcium-independent)

Background

PLA2G4C, also known as Cytosolic phospholipase A2 gamma, has 3 isoforms, a 541 amino acid isoform that is 61 kDa, a 527 amino acid isoform that is 59 kDa and a 551 amino acid isoform that is 62 kDa; highly expressed in heart and skeletal muscle; hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules has been shown to be a calcium-independent and membrane bound enzyme, and has a preference for arachidonic acid at the sn-2 position of phosphatidylcholine as compared with palmitic acid. This protein has being studied for its involvement in oligodendroglioma, ovarian cancer, breast cancer, schizophrenia, and neuronitis. PLA2G4C protein has been observed with relation to S100A10, MBOAT2, GPCPD1, LPCAT1, and LPCAT2 in immune response CD16 signaling in NK cells, development Leptin signaling via JAK/STAT and MAPK cascades, development Alpha-2 adrenergic receptor activation of ERK, immune response CCR3 signaling in eosinophils, neurophysiological process PGE2-induced pain processing, chemokine signaling, DHA signaling, VEGF family ligands and receptor interactions, antioxidant action of vitamin-C, LDL oxidation in atherogenesis, phospholipases, acyl chain remodelling of PE, metabolism, acyl chain remodelling of PC, hydrolysis of LPC, and phospholipid metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: IP, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-24593
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-92846
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-59576
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DVC00
Species: Hu
Applications: ELISA
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-94062
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85480PEP
Species: Hu
Applications: AC

Publications for PLA2G4C Protein (NBP1-85480PEP) (0)

There are no publications for PLA2G4C Protein (NBP1-85480PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G4C Protein (NBP1-85480PEP) (0)

There are no reviews for PLA2G4C Protein (NBP1-85480PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLA2G4C Protein (NBP1-85480PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLA2G4C Products

Research Areas for PLA2G4C Protein (NBP1-85480PEP)

Find related products by research area.

Blogs on PLA2G4C

There are no specific blogs for PLA2G4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLA2G4C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G4C