PLA2G4C Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PLA2G4C Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2G4C.
  
  

  Source: E. coli

  Amino Acid Sequence: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PLA2G4C
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85480.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLA2G4C Recombinant Protein Antigen

• cPLA2-gamma
• cytosolic phospholipase A2 gamma
• DKFZp586C0423
• EC 3.1.1.4
• FLJ42247
• FLJ44164
• Phospholipase A2 group IVC
• phospholipase A2, group IVC (cytosolic, calcium-independent)

Background

PLA2G4C, also known as Cytosolic phospholipase A2 gamma, has 3 isoforms, a 541 amino acid isoform that is 61 kDa, a 527 amino acid isoform that is 59 kDa and a 551 amino acid isoform that is 62 kDa; highly expressed in heart and skeletal muscle; hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules has been shown to be a calcium-independent and membrane bound enzyme, and has a preference for arachidonic acid at the sn-2 position of phosphatidylcholine as compared with palmitic acid. This protein has being studied for its involvement in oligodendroglioma, ovarian cancer, breast cancer, schizophrenia, and neuronitis. PLA2G4C protein has been observed with relation to S100A10, MBOAT2, GPCPD1, LPCAT1, and LPCAT2 in immune response CD16 signaling in NK cells, development Leptin signaling via JAK/STAT and MAPK cascades, development Alpha-2 adrenergic receptor activation of ERK, immune response CCR3 signaling in eosinophils, neurophysiological process PGE2-induced pain processing, chemokine signaling, DHA signaling, VEGF family ligands and receptor interactions, antioxidant action of vitamin-C, LDL oxidation in atherogenesis, phospholipases, acyl chain remodelling of PE, metabolism, acyl chain remodelling of PC, hydrolysis of LPC, and phospholipid metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PLA2G4C