PLA2G1B Antibody (2B7) - Azide and BSA Free

Western Blot: PLA2G1B Antibody (2B7) [H00005319-M14] - Analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B monoclonal antibody (M14), clone 2B7. Lane 1: PLA2G1B transfected lysate (Predicted MW: 16.4 KDa). Lane 2: Non-transfected lysate.

Western Blot: PLA2G1B Antibody (2B7) [H00005319-M14] - detection against Immunogen (32.05 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLA2G1B Antibody (2B7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PLA2G1B (AAH05386, 17 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
• Specificity: PLA2G1B (2B7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLA2G1B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLA2G1B Antibody (2B7) - Azide and BSA Free

• Group IB phospholipase A2
• Phosphatidylcholine 2-acylhydrolase 1B
• phospholipase A2
• phospholipase A2, group IB (pancreas)
• PLA2
• PLA2A
• PLA2AMGC119834
• PLA2EC 3.1.1.4
• PLA2G1B
• PPLA2
• PPLA2MGC119835

Background

Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]) .[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLA2G1B
• Entrez:
  • 5319(Human)
• OMIM:
  • 172410(Human)
• Uniprot:
  • AAH05386(Human)