PKI-beta Antibody (7F8) - Azide and BSA Free

Sandwich ELISA: PKI-beta Antibody (7F8) [H00005570-M01-100ug] - Detection limit for recombinant GST tagged PKIB is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 7F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PKI-beta Antibody (7F8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PKI-beta Antibody (7F8) - Azide and BSA Free (H00005570-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PKIB (NP_115860.1, 2 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSV
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PKIB
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:100-1:2000

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKI-beta Antibody (7F8) - Azide and BSA Free

• cAMP-dependent protein kinase inhibitor 2
• cAMP-dependent protein kinase inhibitor beta
• FLJ23817
• PKI-beta
• PRKACN2
• protein kinase (cAMP-dependent, catalytic) inhibitor beta

Background

PKI-beta is encoded by this gene is a member of the cAMP-dependent protein kinase inhibitor family. Studies of a similar protein in rat suggest that this protein may interact with the catalytic subunit of cAMP-dependent protein kinase and act as a competitive inhibitor. At least three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKIB
• Entrez:
  • 5570(Human)
• OMIM:
  • 606914(Human)
• Uniprot:
  • NP_115860.1(Human)