PIP5K2 gamma Recombinant Protein Antigen

Images

 
There are currently no images for PIP5K2 gamma Protein (NBP1-92272PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIP5K2 gamma Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIP4K2C.

Source: E. coli

Amino Acid Sequence: LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIP4K2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92272.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIP5K2 gamma Recombinant Protein Antigen

  • EC 2.7.1
  • EC 2.7.1.149
  • FLJ22055
  • phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
  • Phosphatidylinositol-5-phosphate 4-kinase type II gamma
  • phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
  • phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
  • PI(5)P 4-kinase type II gamma
  • PIP4KII-gamma
  • PIP5K2C

Background

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00200576-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-61784
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-34078
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-03492
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-92272PEP
Species: Hu
Applications: AC

Publications for PIP5K2 gamma Protein (NBP1-92272PEP) (0)

There are no publications for PIP5K2 gamma Protein (NBP1-92272PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5K2 gamma Protein (NBP1-92272PEP) (0)

There are no reviews for PIP5K2 gamma Protein (NBP1-92272PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIP5K2 gamma Protein (NBP1-92272PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIP5K2 gamma Products

Blogs on PIP5K2 gamma

There are no specific blogs for PIP5K2 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIP5K2 gamma Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIP4K2C