PIP5K2 gamma Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PIP5K2 gamma Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIP4K2C.
  
  

  Source: E. coli

  Amino Acid Sequence: LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PIP4K2C
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92272.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIP5K2 gamma Recombinant Protein Antigen

• EC 2.7.1
• EC 2.7.1.149
• FLJ22055
• phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
• Phosphatidylinositol-5-phosphate 4-kinase type II gamma
• phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
• phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
• PI(5)P 4-kinase type II gamma
• PIP4KII-gamma
• PIP5K2C

Background

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PIP4K2C