PIP5K2 gamma Antibody

Western Blot: PIP5K2 gamma Antibody [NBP2-56140] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: PIP5K2 gamma Antibody [NBP2-56140] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Discontinued

PIP5K2 gamma Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQY
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIP4K2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIP5K2 gamma Antibody

• EC 2.7.1
• EC 2.7.1.149
• FLJ22055
• phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
• Phosphatidylinositol-5-phosphate 4-kinase type II gamma
• phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
• phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
• PI(5)P 4-kinase type II gamma
• PIP4KII-gamma
• PIP5K2C

Background

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP4K2C