PIP5K1 alpha Antibody - BSA Free

Western Blot: PIP5K1 alpha Antibody [NBP2-88053] - Host: Rabbit. Target Name: PIP5K1A. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIP5K1 alpha Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIP5K1 alpha. Peptide sequence: LYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIP5K1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIP5K1 alpha Antibody - BSA Free

• 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase alpha
• EC 2.7.1
• EC 2.7.1.68
• Phosphatidylinositol-4-phosphate 5-kinase type I alpha
• phosphatidylinositol-4-phosphate 5-kinase type-1 alpha
• phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
• PIP5K1-alpha
• PIP5KIalpha
• PtdIns(4)P-5-kinase 1 alpha

Background

Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP5K1A