PIP5K1 alpha Antibody


Western Blot: PIP5K1 alpha Antibody [NBP2-88052] - Host: Rabbit. Target Name: PIP5K1A. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PIP5K1 alpha Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of Human PIP5K1 alpha. Peptide sequence: GGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDL The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for PIP5K1 alpha Antibody

  • 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase alpha
  • EC 2.7.1
  • EC
  • Phosphatidylinositol-4-phosphate 5-kinase type I alpha
  • phosphatidylinositol-4-phosphate 5-kinase type-1 alpha
  • phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
  • PIP5K1-alpha
  • PIP5KIalpha
  • PtdIns(4)P-5-kinase 1 alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIP5K1 alpha Antibody (NBP2-88052) (0)

There are no publications for PIP5K1 alpha Antibody (NBP2-88052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5K1 alpha Antibody (NBP2-88052) (0)

There are no reviews for PIP5K1 alpha Antibody (NBP2-88052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIP5K1 alpha Antibody (NBP2-88052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PIP5K1 alpha Products

Bioinformatics Tool for PIP5K1 alpha Antibody (NBP2-88052)

Discover related pathways, diseases and genes to PIP5K1 alpha Antibody (NBP2-88052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIP5K1 alpha Antibody (NBP2-88052)

Discover more about diseases related to PIP5K1 alpha Antibody (NBP2-88052).

Pathways for PIP5K1 alpha Antibody (NBP2-88052)

View related products by pathway.

PTMs for PIP5K1 alpha Antibody (NBP2-88052)

Learn more about PTMs related to PIP5K1 alpha Antibody (NBP2-88052).

Blogs on PIP5K1 alpha

There are no specific blogs for PIP5K1 alpha, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIP5K1 alpha Antibody and receive a gift card or discount.


Gene Symbol PIP5K1A