PIEZO2 Recombinant Protein Antigen

Images

 
There are currently no images for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIEZO2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIEZO2.

Source: E. coli

Amino Acid Sequence: QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIEZO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58161.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIEZO2 Recombinant Protein Antigen

  • C18orf30
  • C18orf58
  • DA3
  • DA5
  • DAIPT
  • FAM38B
  • FAM38B2
  • family with sequence similarity 38, member A pseud
  • family with sequence similarity 38, member B
  • family with sequence similarity 38, member B2
  • FLJ23144
  • FLJ23403
  • FLJ25916
  • FLJ34907
  • FLJ37734
  • FLJ45725
  • HsT748
  • HsT771
  • MWKS
  • PIEZO2
  • piezo-type mechanosensitive ion channel component
  • piezo-type mechanosensitive ion channel component 2
  • protein PIEZO2

Background

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78537
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB110-92756
Species: Ch, Hu, Mu, Re
Applications: KD, WB
NBP1-86101
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31237
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80724
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80859
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1396
Species: Hu
Applications: WB
NBP1-46328
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89395
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-43541
Species: Hu
Applications: ELISA, WB

Publications for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP) (0)

There are no publications for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP) (0)

There are no reviews for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP). (Showing 1 - 1 of 1 FAQ).

  1. In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?
    • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see <a href=" http://may2012.archive.ensembl.org/Homo_sapiens/Gene/Summary?g=ENSG00000154864;r=18:10670238-11148761" target="_blank">Ensembl </a> for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Additional PIEZO2 Products

Array NBP2-58161PEP

Research Areas for PIEZO2 Recombinant Protein Antigen (NBP2-58161PEP)

Find related products by research area.

Blogs on PIEZO2.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ...  Read full blog post.

PIEZO1: A Mechanosensitive Ion Channel Protein
PIEZO1, and its close homologue PIEZO2, are mechanosensitive ion channel proteins. Mechanosensitive ion channels couple protein conformation to the mechanics of the surrounding membrane, and switch between a closed state and an open state in response ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIEZO2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIEZO2