PIEZO2 Antibody


Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP2-13759] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PIEZO2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FEDENKAAVRIMAGDNVEICMNLDAASFSQHNP
Specificity of human PIEZO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIEZO2 Protein (NBP2-13759PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PIEZO2 Antibody

  • C18orf30
  • C18orf58
  • FAM38B
  • FAM38B2
  • family with sequence similarity 38, member B
  • family with sequence similarity 38, member B2
  • FLJ23144
  • FLJ23403
  • FLJ25916
  • FLJ34907
  • FLJ37734
  • FLJ45725
  • HsT748
  • HsT771
  • piezo-type mechanosensitive ion channel component 2
  • protein PIEZO2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Ch, Re
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PIEZO2 Antibody (NBP2-13759) (0)

There are no publications for PIEZO2 Antibody (NBP2-13759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIEZO2 Antibody (NBP2-13759) (0)

There are no reviews for PIEZO2 Antibody (NBP2-13759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIEZO2 Antibody (NBP2-13759). (Showing 1 - 1 of 1 FAQ).

  1. In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?
    • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see <a href=" http://may2012.archive.ensembl.org/Homo_sapiens/Gene/Summary?g=ENSG00000154864;r=18:10670238-11148761" target="_blank">Ensembl </a> for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Secondary Antibodies


Isotype Controls

Additional PIEZO2 Products

Bioinformatics Tool for PIEZO2 Antibody (NBP2-13759)

Discover related pathways, diseases and genes to PIEZO2 Antibody (NBP2-13759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIEZO2 Antibody (NBP2-13759)

Discover more about diseases related to PIEZO2 Antibody (NBP2-13759).

Pathways for PIEZO2 Antibody (NBP2-13759)

View related products by pathway.

Research Areas for PIEZO2 Antibody (NBP2-13759)

Find related products by research area.

Blogs on PIEZO2.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for...  Read full blog post.

PIEZO1: A Mechanosensitive Ion Channel Protein
PIEZO1, and its close homologue PIEZO2, are mechanosensitive ion channel proteins. Mechanosensitive ion channels couple protein conformation to the mechanics of the surrounding membrane, and switch between a closed state and an open state in response...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIEZO2 Antibody and receive a gift card or discount.


Gene Symbol PIEZO2