PIEZO2 Antibody

Product Discontinued

PIEZO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FEDENKAAVRIMAGDNVEICMNLDAASFSQHNP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIEZO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIEZO2 Antibody

• C18orf30
• C18orf58
• DA3
• DA5
• DAIPT
• FAM38B
• FAM38B2
• family with sequence similarity 38, member A pseud
• family with sequence similarity 38, member B
• family with sequence similarity 38, member B2
• FLJ23144
• FLJ23403
• FLJ25916
• FLJ34907
• FLJ37734
• FLJ45725
• HsT748
• HsT771
• MWKS
• PIEZO2
• piezo-type mechanosensitive ion channel component
• piezo-type mechanosensitive ion channel component 2
• protein PIEZO2

Background

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PIEZO2 Antibody (NBP2-13759). (Showing 1 - 1 of 1 FAQ).

1. In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?
   • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see <a href=" http://may2012.archive.ensembl.org/Homo_sapiens/Gene/Summary?g=ENSG00000154864;r=18:10670238-11148761" target="_blank">Ensembl </a> for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Bioinformatics

• Gene Symbol: PIEZO2