PIEZO2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding PIEZO2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human gallbladder shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human prostate shows strong membranous positivity in smooth muscle cells and weak in glandular cells..
Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human testis shows weak to moderate membranous positivity in Leydig cells and cells in seminiferous ducts.

Product Details

Summary
Product Discontinued
View other related PIEZO2 Primary Antibodies
Validated by:
       

Orthogonal Strategies

 

Order Details


    • Catalog Number
      NBP1-89892
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIEZO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEEDFNGGDGVEGELEESTKLKMFRRLASVASKLK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIEZO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP1-89892.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Reactivity reported in scientific literature (PMID: 24662763)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIEZO2 Antibody

  • C18orf30
  • C18orf58
  • DA3
  • DA5
  • DAIPT
  • FAM38B
  • FAM38B2
  • family with sequence similarity 38, member A pseud
  • family with sequence similarity 38, member B
  • family with sequence similarity 38, member B2
  • FLJ23144
  • FLJ23403
  • FLJ25916
  • FLJ34907
  • FLJ37734
  • FLJ45725
  • HsT748
  • HsT771
  • MWKS
  • PIEZO2
  • piezo-type mechanosensitive ion channel component
  • piezo-type mechanosensitive ion channel component 2
  • protein PIEZO2

Background

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78537
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB110-92756
Species: Ch, Hu, Mu, Re
Applications: KD, WB
NBP1-86101
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83132
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-80724
Species: Hu
Applications: IHC,  IHC-P
NBP1-80859
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1396
Species: Hu
Applications: WB
NBP1-46328
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89395
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-43541
Species: Hu
Applications: ELISA, WB

Publications for PIEZO2 Antibody (NBP1-89892)(1)

Reviews for PIEZO2 Antibody (NBP1-89892) (0)

There are no reviews for PIEZO2 Antibody (NBP1-89892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIEZO2 Antibody (NBP1-89892). (Showing 1 - 2 of 2 FAQ).

  1. In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?
    • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see <a href=" http://may2012.archive.ensembl.org/Homo_sapiens/Gene/Summary?g=ENSG00000154864;r=18:10670238-11148761" target="_blank">Ensembl </a> for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.
  2. In my project we need Anti-Piezo2 and we find it in your catalog: PIEZO2 Antibody (NBP1-89892) with western blot application. There I can see the result of a western blot. I want to know the prediction size of your antibody. The size of the protein is more than 200 kDa, but in this photo there are some sharp band around 50 kd. Are there the actual bands?
    • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see Ensembl for more information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Secondary Antibodies

 

Isotype Controls

Additional PIEZO2 Products

Research Areas for PIEZO2 Antibody (NBP1-89892)

Find related products by research area.

Blogs on PIEZO2.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ...  Read full blog post.

PIEZO1: A Mechanosensitive Ion Channel Protein
PIEZO1, and its close homologue PIEZO2, are mechanosensitive ion channel proteins. Mechanosensitive ion channels couple protein conformation to the mechanics of the surrounding membrane, and switch between a closed state and an open state in response ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIEZO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIEZO2