PIEZO2 Antibody

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding PIEZO2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human gallbladder shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human lung shows strong membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human prostate shows strong membranous positivity in smooth muscle cells and weak in glandular cells..

Immunohistochemistry-Paraffin: PIEZO2 Antibody [NBP1-89892] - Staining of human testis shows weak to moderate membranous positivity in Leydig cells and cells in seminiferous ducts.

Product Discontinued

PIEZO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEEDFNGGDGVEGELEESTKLKMFRRLASVASKLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIEZO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Reactivity reported in scientific literature (PMID: 24662763)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIEZO2 Antibody

• C18orf30
• C18orf58
• DA3
• DA5
• DAIPT
• FAM38B
• FAM38B2
• family with sequence similarity 38, member A pseud
• family with sequence similarity 38, member B
• family with sequence similarity 38, member B2
• FLJ23144
• FLJ23403
• FLJ25916
• FLJ34907
• FLJ37734
• FLJ45725
• HsT748
• HsT771
• MWKS
• PIEZO2
• piezo-type mechanosensitive ion channel component
• piezo-type mechanosensitive ion channel component 2
• protein PIEZO2

Background

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIEZO2 Antibody (NBP1-89892)(1)

Publication using NBP1-89892

• Poole K, Herget R, Lapatsina L et al. Tuning Piezo ion channels to detect molecular-scale movements relevant for fine touch. Nat Commun 2014-03-24 [PMID: 24662763]

FAQs for PIEZO2 Antibody (NBP1-89892). (Showing 1 - 2 of 2 FAQ).

1. In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?
   • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see <a href=" http://may2012.archive.ensembl.org/Homo_sapiens/Gene/Summary?g=ENSG00000154864;r=18:10670238-11148761" target="_blank">Ensembl </a> for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.
2. In my project we need Anti-Piezo2 and we find it in your catalog: PIEZO2 Antibody (NBP1-89892) with western blot application. There I can see the result of a western blot. I want to know the prediction size of your antibody. The size of the protein is more than 200 kDa, but in this photo there are some sharp band around 50 kd. Are there the actual bands?
   • The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see Ensembl for more information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Bioinformatics

• Gene Symbol: PIEZO2