We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PHLPP Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related PHLPP Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-33887PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PHLPP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHLPP1.

Source: E. coli

Amino Acid Sequence: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHLPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33887.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHLPP Recombinant Protein Antigen

  • EC 3.1.3.16
  • hSCOP
  • KIAA0606
  • MGC161555
  • PH domain and leucine rich repeat protein phosphatase 1
  • PH domain and leucine rich repeat protein phosphatase
  • PH domain leucine-rich repeat-containing protein phosphatase 1
  • PHLPP
  • pleckstrin homology domain containing, family E (with leucine rich repeats)member 1
  • Pleckstrin homology domain-containing family E member 1
  • PLEKHE1
  • SCN circadian oscillatory protein
  • SCOPPH domain-containing family E member 1
  • Suprachiasmatic nucleus circadian oscillatory protein

Background

PHLPP (PH domain leucine-rich repeat-containing protein phosphatase) is responsible for the dephosphorylation and subsequent inactivation of Akt. Akt is a signaling protein critical to the balance of cell survival and apoptosis. Dephosphorylation of Akt by PHLPP has been demonstrated to trigger apoptosis and suppress tumor cell growth. PHLPP functions similarly to its relative PHLPPL, also known as PHLPPL2. Recent studies show that PHLPP and PHLPPL selectively terminate Akt-signaling by targeting specific Akt isoforms. Alternate names for PHLPP include pleckstrin homology domain-containing family E protein 1, suprachiasmatic nucleus circadian oscillatory protein, hSCOP, PHLPP1, KIAA0606, PLEKHE1, and SCOP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-1812
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Publications for PHLPP Protein (NBP2-33887PEP) (0)

There are no publications for PHLPP Protein (NBP2-33887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHLPP Protein (NBP2-33887PEP) (0)

There are no reviews for PHLPP Protein (NBP2-33887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHLPP Protein (NBP2-33887PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHLPP Products

Array NBP2-33887PEP

Research Areas for PHLPP Protein (NBP2-33887PEP)

Find related products by research area.

Blogs on PHLPP

There are no specific blogs for PHLPP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHLPP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLPP1