PHLPP Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ |
| Predicted Species |
Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PHLPP1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for PHLPP Antibody
Background
PHLPP (PH domain leucine-rich repeat-containing protein phosphatase) is responsible for the dephosphorylation and subsequent inactivation of Akt. Akt is a signaling protein critical to the balance of cell survival and apoptosis. Dephosphorylation of Akt by PHLPP has been demonstrated to trigger apoptosis and suppress tumor cell growth. PHLPP functions similarly to its relative PHLPPL, also known as PHLPPL2. Recent studies show that PHLPP and PHLPPL selectively terminate Akt-signaling by targeting specific Akt isoforms. Alternate names for PHLPP include pleckstrin homology domain-containing family E protein 1, suprachiasmatic nucleus circadian oscillatory protein, hSCOP, PHLPP1, KIAA0606, PLEKHE1, and SCOP.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Publications for PHLPP Antibody (NBP2-33887) (0)
There are no publications for PHLPP Antibody (NBP2-33887).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHLPP Antibody (NBP2-33887) (0)
There are no reviews for PHLPP Antibody (NBP2-33887).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PHLPP Antibody (NBP2-33887) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PHLPP Products
Research Areas for PHLPP Antibody (NBP2-33887)
Find related products by research area.
|
Blogs on PHLPP