PHLPP Antibody

Immunohistochemistry-Paraffin: PHLPP Antibody [NBP2-33887] - Staining of human urinary bladder shows strong cytoplasmic positivity.

Product Discontinued

PHLPP Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHLPP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PHLPP Protein (NBP2-33887PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHLPP Antibody

• EC 3.1.3.16
• hSCOP
• KIAA0606
• MGC161555
• PH domain and leucine rich repeat protein phosphatase 1
• PH domain and leucine rich repeat protein phosphatase
• PH domain leucine-rich repeat-containing protein phosphatase 1
• PHLPP
• pleckstrin homology domain containing, family E (with leucine rich repeats)member 1
• Pleckstrin homology domain-containing family E member 1
• PLEKHE1
• SCN circadian oscillatory protein
• SCOPPH domain-containing family E member 1
• Suprachiasmatic nucleus circadian oscillatory protein

Background

PHLPP (PH domain leucine-rich repeat-containing protein phosphatase) is responsible for the dephosphorylation and subsequent inactivation of Akt. Akt is a signaling protein critical to the balance of cell survival and apoptosis. Dephosphorylation of Akt by PHLPP has been demonstrated to trigger apoptosis and suppress tumor cell growth. PHLPP functions similarly to its relative PHLPPL, also known as PHLPPL2. Recent studies show that PHLPP and PHLPPL selectively terminate Akt-signaling by targeting specific Akt isoforms. Alternate names for PHLPP include pleckstrin homology domain-containing family E protein 1, suprachiasmatic nucleus circadian oscillatory protein, hSCOP, PHLPP1, KIAA0606, PLEKHE1, and SCOP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHLPP1
• Uniprot:
  • O60346(Human)