Home » PHKA1 » PHKA1 Antibodies » PHKA1 Antibody

PHKA1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml
Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PHKA1 Antibody Summary

Immunogen
The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human PHKA1. Peptide sequence: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PHKA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHKA1 Antibody

  • MGC132604
  • PHKA
  • phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform
  • phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
  • Phosphorylase kinase alpha M subunit
  • phosphorylase kinase, alpha 1 (muscle)
  • phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PHKA2 Antibody
NBP1-92264
Immunohistochemistry: PHKA2 Antibody [NBP1-92264] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: PHKA2 Antibody [NBP1-92264] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RPS4X Antibody
NBP2-94118
Western Blot: RPS4X Antibody [NBP2-94118] - Western blot analysis of extracts of various cell lines, using RPS4X antibody (NBP2-94118) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: WB
Glycogen
phosphorylase, muscle ...
NBP2-16689
Immunohistochemistry-Paraffin: Glycogen phosphorylase, muscle form Antibody [NBP2-16689] - Human breast cancer. PYGM antibody [C1C3] dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Glycogen phosphorylase, muscle form Antibody [NBP2-16689] - Sample (30 ug of whole cell lysate) A: HeLa 7.5% SDS PAGE diluted at 1:1000
Western Blot: Glycogen phosphorylase, muscle form Antibody [NBP2-16689] - Sample (50 ug of whole cell lysate) A: Mouse brain 7.5% SDS PAGE diluted at 1:1000
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
Recombinant Human
Phosphorylase B GST ( ...
H00005257-Q01
SDS-Page: Recombinant Human Phosphorylase B Protein [H00005257-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Recombinant Human
RPS4Y1 GST (N-Term) P ...
H00006192-P01
SDS-Page: Recombinant Human RPS4Y1 Protein [H00006192-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MCT8/SLC16A2
Antibody
NBP2-57308
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RPS2 Antibody (3G6)
H00006187-M01
Western Blot: RPS2 Antibody (3G6) [H00006187-M01] - RPS2 monoclonal antibody (M01), clone 3G6. Analysis of RPS2 expression in human liver.
Immunocytochemistry/Immunofluorescence: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.2 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PGK1 Antibody
NBP2-19784
Western Blot: PGK1 Antibody [NBP2-19784] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PGK1 antibody diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PGK1 Antibody [NBP2-19784] - Analysis of methanol-fixed HeLa, using antibody at 1:50 dilution.
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-19784] - Analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
PSMC1 Antibody
NBP1-80959
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear postivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human skeletal muscle shows moderate nuclear postivity in myocytes.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MTSS1 Antibody
NBP2-24716
Immunohistochemistry-Paraffin: MTSS1 Antibody [NBP2-24716] - Analysis of human colon using this antibody at 10 ug/ml.
Western Blot: MTSS1 Antibody [NBP2-24716] - Analysis of MTSS1 in human testis lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat testis lysate using NBP2-24716 at 2 ug/ml, 4 ug/ml and 2 ug/ml, respectively.
(1 Publication)
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cervix shows moderate to strong positivity in mucus in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for PHKA1 Antibody (NBP2-83392) (0)

There are no publications for PHKA1 Antibody (NBP2-83392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKA1 Antibody (NBP2-83392) (0)

There are no reviews for PHKA1 Antibody (NBP2-83392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHKA1 Antibody (NBP2-83392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHKA1 Products

Bioinformatics Tool for PHKA1 Antibody (NBP2-83392)

Discover related pathways, diseases and genes to PHKA1 Antibody (NBP2-83392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKA1 Antibody (NBP2-83392)

Discover more about diseases related to PHKA1 Antibody (NBP2-83392).
 

Pathways for PHKA1 Antibody (NBP2-83392)

View related products by pathway.

PTMs for PHKA1 Antibody (NBP2-83392)

Learn more about PTMs related to PHKA1 Antibody (NBP2-83392).
 

Research Areas for PHKA1 Antibody (NBP2-83392)

Find related products by research area.

Blogs on PHKA1

There are no specific blogs for PHKA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHKA1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PHKA1