PHKA1 Antibody - BSA Free

Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PHKA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHKA1 Antibody - BSA Free (NBP2-83392) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human PHKA1. Peptide sequence: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHKA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PHKA1 Antibody - BSA Free

• MGC132604
• PHKA
• phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform
• phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
• Phosphorylase kinase alpha M subunit
• phosphorylase kinase, alpha 1 (muscle)
• phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Background

The PHKA1 gene encodes the alpha subunit of muscle phosphorylase kinase (EC 2.7.1.38), a key regulatory enzyme of glycogen metabolism. Phosphorylase kinase consists of 4 copies of an alpha-beta-gamma-delta tetramer. The alpha, beta (PHKB; MIM 172490), and gamma (PHKG1; MIM 172470 and PHKG2; MIM 172471) subunits have several isoforms; the delta subunit is calmodulin (CALM1; MIM 114180). PHKA2 (MIM 306000) encodes the alpha subunit of liver-specific phosphorylase kinase and is also located on the X chromosome.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHKA1