PHKA1 Antibody

Images

 
Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHKA1 Antibody Summary

Immunogen
The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human PHKA1. Peptide sequence: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PHKA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHKA1 Antibody

  • MGC132604
  • PHKA
  • phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform
  • phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
  • Phosphorylase kinase alpha M subunit
  • phosphorylase kinase, alpha 1 (muscle)
  • phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92264
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
NBP2-16689
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00005257-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for PHKA1 Antibody (NBP2-83392) (0)

There are no publications for PHKA1 Antibody (NBP2-83392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKA1 Antibody (NBP2-83392) (0)

There are no reviews for PHKA1 Antibody (NBP2-83392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHKA1 Antibody (NBP2-83392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHKA1 Products

Bioinformatics Tool for PHKA1 Antibody (NBP2-83392)

Discover related pathways, diseases and genes to PHKA1 Antibody (NBP2-83392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKA1 Antibody (NBP2-83392)

Discover more about diseases related to PHKA1 Antibody (NBP2-83392).
 

Pathways for PHKA1 Antibody (NBP2-83392)

View related products by pathway.

PTMs for PHKA1 Antibody (NBP2-83392)

Learn more about PTMs related to PHKA1 Antibody (NBP2-83392).
 

Research Areas for PHKA1 Antibody (NBP2-83392)

Find related products by research area.

Blogs on PHKA1

There are no specific blogs for PHKA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHKA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKA1