PHF22 Antibody - BSA Free

Western Blot: PHF22 Antibody [NBP1-92263] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: PHF22 Antibody [NBP1-92263] - Staining of human cell line A-431 shows localization to nuclear bodies & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PHF22 Antibody [NBP1-92263] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Analysis in human cell line MOLT-4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHF22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHF22 Antibody - BSA Free (NBP1-92263) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PHF22 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCH
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INTS12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHF22 Protein (NBP1-92263PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24058608)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PHF22 Antibody - BSA Free

• Int12
• integrator complex subunit 12
• PHD finger protein 22INT12
• PHF22
• SBBI22

Background

INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHF22 Antibody (NBP1-92263)(1)

Publication using NBP1-92263

• Obeidat M, Miller S, Probert K et al. GSTCD and INTS12 Regulation and Expression in the Human Lung. PLoS One. 2013-09-18 [PMID: 24058608]

Bioinformatics

• Gene Symbol: INTS12