We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PDZD2/PDZK3 Recombinant Protein Antigen

Images

 
There are currently no images for PDZD2/PDZK3 Protein (NBP2-39026PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDZD2/PDZK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDZD2.

Source: E. coli

Amino Acid Sequence: LMVGVDVSGASYLAEQCWNGGFIYLIMLRRFKHKAHSTYNGNSSNSSEPGETPTLELGDRTAKKGKRTRKFGVISRPPANKAPEESKGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDZD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39026.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDZD2/PDZK3 Recombinant Protein Antigen

  • Activated in prostate cancer protein
  • AIPC
  • AIPCPAPIN
  • KIAA0300
  • KIAA0300PDZ domain-containing protein 3
  • Papin
  • PDZ domain containing 2
  • PDZ domain containing 3
  • PDZ domain-containing protein 2
  • PDZD2
  • PDZK3
  • Pin1

Background

Proteins containing PDZ domains have been shown frequently to bind the C-termini of transmembrane receptors or ion channels. They have also been shown to bind to other PDZ domain proteins and could possibly be involved in intracellular signalling. The protein encoded by this gene contains six PDZ domains and shares sequence similarity with pro-interleukin-16 (pro-IL-16). Like pro-IL-16, the encoded protein localizes to the endoplasmic reticulum and is thought to be cleaved by a caspase to produce a secreted peptide containing two PDZ domains. In addition, this gene is upregulated in primary prostate tumors and may be involved in the early stages of prostate tumorigenesis. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NBP3-00253
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
MAB4356
Species: Hu, Mu, Rt
Applications: WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49242
Species: Hu
Applications: IHC,  IHC-P, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85360
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88766
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38905
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83889
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87929
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-85921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13794
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83887
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB

Publications for PDZD2/PDZK3 Protein (NBP2-39026PEP) (0)

There are no publications for PDZD2/PDZK3 Protein (NBP2-39026PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDZD2/PDZK3 Protein (NBP2-39026PEP) (0)

There are no reviews for PDZD2/PDZK3 Protein (NBP2-39026PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDZD2/PDZK3 Protein (NBP2-39026PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDZD2/PDZK3 Products

Blogs on PDZD2/PDZK3

There are no specific blogs for PDZD2/PDZK3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDZD2/PDZK3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZD2