PCDHA3 Antibody


Western Blot: PCDHA3 Antibody [NBP1-87323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PCDHA3 Antibody [NBP1-87323] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and golgi apparatus.
Immunohistochemistry-Paraffin: PCDHA3 Antibody [NBP1-87323] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PCDHA3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAI
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCDHA3 Protein (NBP1-87323PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PCDHA3 Antibody

  • KIAA0345-like 11
  • MGC141669
  • PCDH-alpha-3
  • protocadherin alpha 3
  • protocadherin alpha-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr

Publications for PCDHA3 Antibody (NBP1-87323) (0)

There are no publications for PCDHA3 Antibody (NBP1-87323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHA3 Antibody (NBP1-87323) (0)

There are no reviews for PCDHA3 Antibody (NBP1-87323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCDHA3 Antibody (NBP1-87323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCDHA3 Products

Bioinformatics Tool for PCDHA3 Antibody (NBP1-87323)

Discover related pathways, diseases and genes to PCDHA3 Antibody (NBP1-87323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHA3 Antibody (NBP1-87323)

Discover more about diseases related to PCDHA3 Antibody (NBP1-87323).

Pathways for PCDHA3 Antibody (NBP1-87323)

View related products by pathway.

Blogs on PCDHA3

There are no specific blogs for PCDHA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCDHA3 Antibody and receive a gift card or discount.


Gene Symbol PCDHA3