Recombinant Human PBX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PBX2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 430 of Human PBX2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PBX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PBX2 Protein

  • G17Homeobox protein PBX2
  • HOX12homeobox 12
  • PBX2MHC
  • pre-B-cell leukemia homeobox 2
  • pre-B-cell leukemia transcription factor 2
  • Protein G17

Background

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB100-2803
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-57898
Species: Hu
Applications: WB, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
H00005089-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PBX2 Recombinant Protein (H00005089-P01) (0)

There are no publications for PBX2 Recombinant Protein (H00005089-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBX2 Recombinant Protein (H00005089-P01) (0)

There are no reviews for PBX2 Recombinant Protein (H00005089-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBX2 Recombinant Protein (H00005089-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PBX2 Products

Bioinformatics Tool for PBX2 Recombinant Protein (H00005089-P01)

Discover related pathways, diseases and genes to PBX2 Recombinant Protein (H00005089-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX2 Recombinant Protein (H00005089-P01)

Discover more about diseases related to PBX2 Recombinant Protein (H00005089-P01).
 

Pathways for PBX2 Recombinant Protein (H00005089-P01)

View related products by pathway.

PTMs for PBX2 Recombinant Protein (H00005089-P01)

Learn more about PTMs related to PBX2 Recombinant Protein (H00005089-P01).

Blogs on PBX2

There are no specific blogs for PBX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PBX2 Antibody
NBP2-31853

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PBX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX2