Recombinant Human PBX2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PBX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 354-430 of Human PBX2

Source: Wheat Germ

Amino Acid Sequence: DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PBX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PBX2 Protein

  • G17Homeobox protein PBX2
  • HOX12homeobox 12
  • PBX2MHC
  • pre-B-cell leukemia homeobox 2
  • pre-B-cell leukemia transcription factor 2
  • Protein G17

Background

PBX2 - pre-B-cell leukemia transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB100-2803
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-57898
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
H00005089-Q02
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PBX2 Partial Recombinant Protein (H00005089-Q02) (0)

There are no publications for PBX2 Partial Recombinant Protein (H00005089-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBX2 Partial Recombinant Protein (H00005089-Q02) (0)

There are no reviews for PBX2 Partial Recombinant Protein (H00005089-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBX2 Partial Recombinant Protein (H00005089-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PBX2 Products

Bioinformatics Tool for PBX2 Partial Recombinant Protein (H00005089-Q02)

Discover related pathways, diseases and genes to PBX2 Partial Recombinant Protein (H00005089-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX2 Partial Recombinant Protein (H00005089-Q02)

Discover more about diseases related to PBX2 Partial Recombinant Protein (H00005089-Q02).
 

Pathways for PBX2 Partial Recombinant Protein (H00005089-Q02)

View related products by pathway.

PTMs for PBX2 Partial Recombinant Protein (H00005089-Q02)

Learn more about PTMs related to PBX2 Partial Recombinant Protein (H00005089-Q02).

Blogs on PBX2

There are no specific blogs for PBX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PBX2 Antibody
NBP2-31853

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PBX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX2