PACE4 Antibody

Images

 
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in PC-12.
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in Hela S3 NE (Cat # L013V3 ).
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in NIH/3T3.
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in Raw 264.7.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PACE4 Antibody Summary

Immunogen
PCSK6 (NP_002561 860 a.a. - 969 a.a.) partial recombinant protein with GST tag. REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Specificity
PCSK6 - proprotein convertase subtilisin/kexin type 6
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PCSK6
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using
H00005046-A01 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PACE4 Antibody

  • EC 3.4.21
  • EC 3.4.21.61
  • EC 3.4.21.75
  • PACE4EC 3.4.21.-
  • Paired basic amino acid cleaving enzyme 4
  • paired basic amino acid cleaving system 4
  • proprotein convertase subtilisin/kexin type 6
  • SPC4subtilisin-like protease
  • Subtilisin/kexin-like protease PACE4
  • Subtilisin-like proprotein convertase 4

Background

The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NB600-816
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PACE4 Antibody (H00005046-A01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using H00005046-A01 Applications Species
Klee, George G, Vasmatzis, George, Kosari et al. EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERS FreshPatents 2010 Feb 04 (ELISA, Human) ELISA Human

Reviews for PACE4 Antibody (H00005046-A01) (0)

There are no reviews for PACE4 Antibody (H00005046-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PACE4 Antibody (H00005046-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PACE4 Antibody (H00005046-A01)

Discover related pathways, diseases and genes to PACE4 Antibody (H00005046-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACE4 Antibody (H00005046-A01)

Discover more about diseases related to PACE4 Antibody (H00005046-A01).
 

Pathways for PACE4 Antibody (H00005046-A01)

View related products by pathway.

PTMs for PACE4 Antibody (H00005046-A01)

Learn more about PTMs related to PACE4 Antibody (H00005046-A01).

Blogs on PACE4

There are no specific blogs for PACE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACE4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK6
Entrez
OMIM
Uniprot