Recombinant Human P2Y6/P2RY6 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human P2Y6/P2RY6 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-102 of Human P2Y6/P2RY6

Source: Wheat Germ

Amino Acid Sequence: MEWDNGTGQALGLPLTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
P2RY6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2Y6/P2RY6 Protein

  • G-coupled nucleotide receptor
  • MGC15335
  • P2 purinoceptor
  • P2RY6
  • P2Y6 receptor
  • P2Y6
  • P2Y6P2Y purinoceptor 6
  • pyrimidinergic receptor P2Y, G-protein coupled, 6

Background

P2RY6 - pyrimidinergic receptor P2Y, G-protein coupled, 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-61760
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00008706-P01
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-92239
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01) (0)

There are no publications for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01) (0)

There are no reviews for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2Y6/P2RY6 Products

Bioinformatics Tool for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01)

Discover related pathways, diseases and genes to P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01)

Discover more about diseases related to P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01).
 

Pathways for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01)

View related products by pathway.

PTMs for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01)

Learn more about PTMs related to P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01).
 

Research Areas for P2Y6/P2RY6 Partial Recombinant Protein (H00005031-Q01)

Find related products by research area.

Blogs on P2Y6/P2RY6

There are no specific blogs for P2Y6/P2RY6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

P2Y2 Antibody
NB110-39032

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2Y6/P2RY6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY6
Entrez