P2Y1/P2RY1 Antibody - BSA Free

Immunohistochemistry-Paraffin: P2Y1/P2RY1 Antibody [NBP1-82439] - Staining of human stomach shows low expression as expected.

Immunohistochemistry-Paraffin: P2Y1/P2RY1 Antibody [NBP1-82439] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: P2Y1/P2RY1 Antibody [NBP1-82439] - Staining in human placenta and stomach tissues using anti-P2RY1 antibody. Corresponding P2RY1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P2Y1/P2RY1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit P2Y1/P2RY1 Antibody - BSA Free (NBP1-82439) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDT
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  P2Y1/P2RY1 Protein (NBP1-82439PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P2Y1/P2RY1 Antibody - BSA Free

• ATP receptor
• P2 purinoceptor subtype Y1
• P2RY1
• P2Y purinoceptor 1
• P2Y1
• P2Y1platelet ADP receptor
• purinergic receptor P2Y, G-protein coupled, 1
• Purinergic receptor

Background

P2Y1 is a Purinergic Receptor that causes a change in platelet shape and potentially leads to platelet aggregation by binding ADP, which results in the mobilization of intracellular calcium ions via activation of phospholipase C. This receptor also mediates the release of the relaxing factor nitric oxide and may be involved in the modulation of neuronal signal transmission. P2Y1 has been reported to be expressed in tissues throughout the body, particularly brain. ESTs have been isolated from human embryo, lung, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for P2Y1/P2RY1 Antibody (NBP1-82439). (Showing 1 - 2 of 2 FAQ).

1. Why is the WB band of liver sample a bit higher?
   • This protein is glycosylated so the molecular weight may vary from tissue to tissue. It appears to be more highly glycosylated in the liver, which is why the band is higher.
2. What was the dilution of the antibody used for WB and was it in milk or BSA?
   • This Western blot was blocked in 5% non-fat dried milk in TBS-Tween (0.5% (v/v) Tween 20, pH7.5; blocking buffer) for 45 minutes at RT or overnight at 4C. The antibody was used at a dilution of 1:250.

Bioinformatics

• Gene Symbol: P2RY1