Recombinant Human P2X7/P2RX7 Protein

Images

 
ELISA: P2X7/P2RX7 Recombinant Protein [H00005027-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human P2X7/P2RX7 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 595 of Human P2RX7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Protein/Peptide Type
Recombinant Protein
Gene
P2RX7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2X7/P2RX7 Protein

  • ATP receptor
  • MGC20089
  • P2RX7
  • P2X purinoceptor 7
  • P2X7
  • P2X7P2X7 receptor
  • P2X7R
  • P2Z receptor
  • purinergic receptor P2X, ligand-gated ion channel, 7
  • purinergic receptor P2X7 variant A
  • Purinergic receptor

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants which would encode different isoforms have been identified although some fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59672
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005027-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for P2X7/P2RX7 Recombinant Protein (H00005027-P01) (0)

There are no publications for P2X7/P2RX7 Recombinant Protein (H00005027-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X7/P2RX7 Recombinant Protein (H00005027-P01) (0)

There are no reviews for P2X7/P2RX7 Recombinant Protein (H00005027-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X7/P2RX7 Recombinant Protein (H00005027-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2X7/P2RX7 Products

Bioinformatics Tool for P2X7/P2RX7 Recombinant Protein (H00005027-P01)

Discover related pathways, diseases and genes to P2X7/P2RX7 Recombinant Protein (H00005027-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X7/P2RX7 Recombinant Protein (H00005027-P01)

Discover more about diseases related to P2X7/P2RX7 Recombinant Protein (H00005027-P01).
 

Pathways for P2X7/P2RX7 Recombinant Protein (H00005027-P01)

View related products by pathway.

PTMs for P2X7/P2RX7 Recombinant Protein (H00005027-P01)

Learn more about PTMs related to P2X7/P2RX7 Recombinant Protein (H00005027-P01).

Blogs on P2X7/P2RX7

There are no specific blogs for P2X7/P2RX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2X7/P2RX7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX7
Entrez