p130Cas/BCAR1 Antibody - BSA Free

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p130Cas/BCAR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p130Cas/BCAR1 Antibody - BSA Free (NBP3-25033) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein p130Cas/BCAR1 using the following amino acid sequence: SGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYEN
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p130Cas/BCAR1 Antibody - BSA Free

• BCAR1
• breast cancer estrogen resistance 1
• Cas scaffolding protein family member 1
• CAS1
• CASFLJ45059
• CASS1
• CASS1CRKASbreast cancer estrogen resistance protein 1
• CRKAS
• Crk-associated substrate p130Cas
• CRK-associated substrate
• FLJ12176
• p130Cas

Background

BCAR1/p130CAS functions as a scaffolding protein for components of various kinase signaling pathways. It is involved in integrin signaling for cell motility as well as netrin signaling for the guidance of commissural axons. Overexpression of BCAR1/p130CAS has been shown to confer antiestrogen resistance in breast cancer cells. Alternate names for BCAR1/p130CAS include breast cancer anti-estrogen resistance protein 1, CRK-associated substrate, CAS scaffolding protein family member 1, CAS, and CRKAS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAR1