Recombinant Human p107 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human p107 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 905-1014 of Human RBL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p107 Protein

  • cellular protein 107,107 kDa retinoblastoma-associated protein
  • cp107
  • p107MGC40006
  • PRB1
  • retinoblastoma-like 1 (p107)
  • retinoblastoma-like protein 1

Background

RBL1 - retinoblastoma-like 1 (p107)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005933-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for p107 Partial Recombinant Protein (H00005933-Q01) (0)

There are no publications for p107 Partial Recombinant Protein (H00005933-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p107 Partial Recombinant Protein (H00005933-Q01) (0)

There are no reviews for p107 Partial Recombinant Protein (H00005933-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p107 Partial Recombinant Protein (H00005933-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p107 Products

Bioinformatics Tool for p107 Partial Recombinant Protein (H00005933-Q01)

Discover related pathways, diseases and genes to p107 Partial Recombinant Protein (H00005933-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p107 Partial Recombinant Protein (H00005933-Q01)

Discover more about diseases related to p107 Partial Recombinant Protein (H00005933-Q01).
 

Pathways for p107 Partial Recombinant Protein (H00005933-Q01)

View related products by pathway.

PTMs for p107 Partial Recombinant Protein (H00005933-Q01)

Learn more about PTMs related to p107 Partial Recombinant Protein (H00005933-Q01).
 

Research Areas for p107 Partial Recombinant Protein (H00005933-Q01)

Find related products by research area.

Blogs on p107

There are no specific blogs for p107, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p107 Antibody
NBP2-33735

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p107 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBL1