OSBPL7 Antibody

Images

 
Western Blot: OSBPL7 Antibody [NBP1-81054] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSBPL7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSENEGSEEEESCTSEITTSLSEEMLDLRGAERCQKGGCVPGRPMGPPRRRCLPAASGPGADVSLWNILRNNIGKDLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSBPL7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OSBPL7 Protein (NBP1-81054PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-81054 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OSBPL7 Antibody

  • ORP-7
  • ORP7MGC71150
  • OSBP-related protein 7
  • oxysterol binding protein-like 7
  • oxysterol-binding protein-related protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19634
Species: Hu
Applications: WB, ICC/IF
NBP2-03327
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92236
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-2448
Species: Hu
Applications: WB, PEP-ELISA
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-81403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSBPL7 Antibody (NBP1-81054) (0)

There are no publications for OSBPL7 Antibody (NBP1-81054).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for OSBPL7 Antibody (NBP1-81054) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using NBP1-81054:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence OSBPL7 NBP1-81054
Enlarge
reviewed by:
Anonymous
IF Human 11/02/2017
View

Summary

ApplicationImmunofluorescence
Sample Tested hela cell
SpeciesHuman
LotA78583

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBPL7 Antibody (NBP1-81054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSBPL7 Products

Bioinformatics Tool for OSBPL7 Antibody (NBP1-81054)

Discover related pathways, diseases and genes to OSBPL7 Antibody (NBP1-81054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for OSBPL7 Antibody (NBP1-81054)

Find related products by research area.

Blogs on OSBPL7

There are no specific blogs for OSBPL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/02/2017
Application: IF
Species: Human

Bioinformatics

Gene Symbol OSBPL7