OSBPL7 Antibody

Images

 
Western Blot: OSBPL7 Antibody [NBP1-81054] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: OSBPL7 Antibody [NBP1-81054] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry: OSBPL7 Antibody [NBP1-81054] - Saining of human duodenum shows membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human cerebral cortex shows moderate nuclear membrane positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

OSBPL7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSENEGSEEEESCTSEITTSLSEEMLDLRGAERCQKGGCVPGRPMGPPRRRCLPAASGPGADVSLWNILRNNIGKDLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSBPL7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
OSBPL7 Protein (NBP1-81054PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Alternate Names for OSBPL7 Antibody

  • ORP-7
  • ORP7MGC71150
  • OSBP-related protein 7
  • oxysterol binding protein-like 7
  • oxysterol-binding protein-related protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92235
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03327
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-81388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92236
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC
NB100-2448
Species: Hu
Applications: WB, PEP-ELISA
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-80917
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19638
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSBPL7 Antibody (NBP1-81054) (0)

There are no publications for OSBPL7 Antibody (NBP1-81054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBPL7 Antibody (NBP1-81054) (0)

There are no reviews for OSBPL7 Antibody (NBP1-81054). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OSBPL7 Antibody (NBP1-81054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSBPL7 Antibody Products

Related Products by Gene

Bioinformatics Tool for OSBPL7 Antibody (NBP1-81054)

Discover related pathways, diseases and genes to OSBPL7 Antibody (NBP1-81054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for OSBPL7 Antibody (NBP1-81054)

Find related products by research area.

Blogs on OSBPL7

There are no specific blogs for OSBPL7, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol OSBPL7

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81054 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought