![Western Blot: OSBPL7 Antibody [NBP1-81054] - Analysis in control (vector only transfected HEK293T lysate) and OSBPL7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/OSBPL7-Antibody-Western-Blot-NBP1-81054-img0008.jpg "Western Blot: OSBPL7 Antibody [NBP1-81054] - Analysis in control (vector only transfected HEK293T lysate) and OSBPL7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSENEGSEEEESCTSEITTSLSEEMLDLRGAERCQKGGCVPGRPMGPPRRRCLPAASGPGADVSLWNILRNNIGKDLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OSBPL7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
---Azide-and-BSA-Free-Western-Blot-NBP2-73160-img0001.jpg)
---Azide-and-BSA-Free-Western-Blot-NBP2-73160-img0002.jpg)
---Azide-and-BSA-Free-Flow-Cytometry-NBP2-73160-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Nora Mellouk |
IF | Human | 11/02/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for OSBPL7 Antibody (NBP1-81054)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/OSBPL7-Antibody-Immunohistochemistry-Paraffin-NBP1-81054-img0011.jpg "Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Small intestine shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Cerebral cortex shows moderate membranous and cytoplasmic positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize2/OSBPL7-Antibody-Immunohistochemistry-Paraffin-NBP1-81054-img0009.jpg "Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Cerebral cortex shows moderate membranous and cytoplasmic positivity in neuronal and glial cells.")
![Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/OSBPL7-Antibody-Immunohistochemistry-Paraffin-NBP1-81054-img0010.jpg "Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize2/OSBPL7-Antibody-Immunohistochemistry-Paraffin-NBP1-81054-img0012.jpg "Immunohistochemistry-Paraffin: OSBPL7 Antibody [NBP1-81054] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells.")
-Flow-Cytometry-NBP2-00935-img0001.jpg)
-Western-Blot-NBP2-00935-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-00935-img0003.jpg)
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_812.jpg)
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_813.jpg)
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/Adiponectin_DRP300_ELISA_173.jpg)
![Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunocytochemistry_6471.jpg)
![Western Blot FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Western_Blot_17166.jpg)
![Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunohistochemistry_7312.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
