Recombinant Human OSBP2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OSBP2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 818-916 of Human OSBP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSBP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSBP2 GST (N-Term) Protein

  • ORP4ORP-4KIAA1664Oxysterol-binding protein-related protein 4
  • OSBPL1
  • OSBPL4
  • OSBP-related protein 4
  • oxysterol binding protein 2
  • oxysterol binding protein-like 1
  • oxysterol binding protein-related protein 4
  • oxysterol-binding protein 2

Background

Oxysterols are byproducts of cholesterol that can have cytotoxic effects on many cell types. The membrane-bound protein encoded by this gene contains a pleckstrin homology (PH) domain and an oxysterol-binding region. It binds oxysterols such as 7-ketocholesterol and may inhibit their cytotoxicity. Alternate transcriptional splice variants have been observed but have not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-1331
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-86088
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92236
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85872
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-80405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00089845-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82968
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1069
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-81054
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-59814
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2448
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-73160
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB

Publications for OSBP2 Partial Recombinant Protein (H00023762-Q01) (0)

There are no publications for OSBP2 Partial Recombinant Protein (H00023762-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBP2 Partial Recombinant Protein (H00023762-Q01) (0)

There are no reviews for OSBP2 Partial Recombinant Protein (H00023762-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBP2 Partial Recombinant Protein (H00023762-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OSBP2 Products

Bioinformatics Tool for OSBP2 Partial Recombinant Protein (H00023762-Q01)

Discover related pathways, diseases and genes to OSBP2 Partial Recombinant Protein (H00023762-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBP2 Partial Recombinant Protein (H00023762-Q01)

Discover more about diseases related to OSBP2 Partial Recombinant Protein (H00023762-Q01).
 

Pathways for OSBP2 Partial Recombinant Protein (H00023762-Q01)

View related products by pathway.

Blogs on OSBP2

There are no specific blogs for OSBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSBP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBP2