ORL1/OPRL1 Antibody

Images

 
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml OPRL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORL1/OPRL1 Antibody Summary

Immunogen
Synthetic peptides corresponding to OPRL1 (opiate receptor-like 1) The peptide sequence was selected from the middle region of OPRL1. Peptide sequence ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPRL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against OPRL1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ORL1/OPRL1 Antibody

  • Kappa-type 3 opioid receptor
  • KOR-3
  • KOR-3MGC34578
  • N/OFQ Receptor
  • Nociceptin Receptor
  • NOCIR
  • NOP Receptor
  • OOR
  • OORORL1kappa3-related opioid receptor
  • opiate receptor-like 1
  • OPRL1
  • ORL1
  • Orphanin FQ Receptor

Background

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB38951
Species: Hu
Applications: IHC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ORL1/OPRL1 Antibody (NBP1-69143) (0)

There are no publications for ORL1/OPRL1 Antibody (NBP1-69143).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORL1/OPRL1 Antibody (NBP1-69143) (0)

There are no reviews for ORL1/OPRL1 Antibody (NBP1-69143). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORL1/OPRL1 Antibody (NBP1-69143) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORL1/OPRL1 Products

Bioinformatics Tool for ORL1/OPRL1 Antibody (NBP1-69143)

Discover related pathways, diseases and genes to ORL1/OPRL1 Antibody (NBP1-69143). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORL1/OPRL1 Antibody (NBP1-69143)

Discover more about diseases related to ORL1/OPRL1 Antibody (NBP1-69143).

Research Areas for ORL1/OPRL1 Antibody (NBP1-69143)

Find related products by research area.

Blogs on ORL1/OPRL1

There are no specific blogs for ORL1/OPRL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORL1/OPRL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPRL1
Entrez
Uniprot