Oocyte Expressed Protein Antibody

Immunohistochemistry: Oocyte Expressed Protein Antibody [NBP2-30762] - Staining of human ovary shows moderate cytoplasmic positivity in oocyte.

Product Discontinued

Oocyte Expressed Protein Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OOEP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Oocyte Expressed Protein Antibody

• C6orf156
• Chromosome 6 Open Reading Frame 156
• FLOPED
• hOEP19
• KH Homology Domain Containing 2
• KH Homology Domain-Containing Protein 2
• KHDC2
• OEP19
• Oocyte And Embryo Protein 19
• Oocyte- And Embryo-Specific Protein 19
• Oocyte Expressed Protein Homolog (Dog)
• Oocyte-Expressed Protein Homolog
• OOEP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OOEP
• Uniprot:
  • A6NGQ2(Human)