OIP5 Antibody (3G10-1D5)

Images

 
Western Blot: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Analysis of OIP5 expression in transfected 293T cell line by OIP5 monoclonal antibody (M01), clone 3G10-1D5.Lane 1: OIP5 transfected lysate(24.7 KDa).Lane 2: ...read more
Immunoprecipitation: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Analysis of OIP5 transfected lysate using anti-OIP5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OIP5 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Detection limit for recombinant GST tagged OIP5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
3G10-1D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OIP5 Antibody (3G10-1D5) Summary

Immunogen
OIP5 (AAH15050, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Specificity
OIP5 - Opa interacting protein 5
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OIP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OIP5 Antibody (3G10-1D5)

  • Cancer/testis antigen 86
  • CT865730547N13Rik
  • hMIS18beta
  • LAP2alpha interactor-25
  • LINT-25
  • MIS18B
  • MIS18beta
  • OIP-5
  • Opa interacting protein 5
  • Opa-interacting protein 5
  • protein Mis18-beta

Background

Commonly referred to as OIP5, Opa interacting protein 5 is essential to protein binding. More specifically, OIP5 is necessary for the recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. OIP5 interacts with other proteins such as RAF1, BRAF, CENPA, CENPN, and HJURP and also binds UBC, TMPO, MIS18A, CASP10 and RARG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92632
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00055320-B01P
Species: Hu
Applications: ICC/IF, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88943
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01308
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-24590
Species: Mu
Applications: IHC, IHC-P, WB
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47663
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00011339-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for OIP5 Antibody (H00011339-M01) (0)

There are no publications for OIP5 Antibody (H00011339-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OIP5 Antibody (H00011339-M01) (0)

There are no reviews for OIP5 Antibody (H00011339-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OIP5 Antibody (H00011339-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OIP5 Products

Bioinformatics Tool for OIP5 Antibody (H00011339-M01)

Discover related pathways, diseases and genes to OIP5 Antibody (H00011339-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OIP5 Antibody (H00011339-M01)

Discover more about diseases related to OIP5 Antibody (H00011339-M01).
 

Pathways for OIP5 Antibody (H00011339-M01)

View related products by pathway.

PTMs for OIP5 Antibody (H00011339-M01)

Learn more about PTMs related to OIP5 Antibody (H00011339-M01).
 

Research Areas for OIP5 Antibody (H00011339-M01)

Find related products by research area.

Blogs on OIP5

There are no specific blogs for OIP5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OIP5 Antibody (3G10-1D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol OIP5
Entrez
OMIM
Uniprot