Home » OIP5 » OIP5 Antibodies » OIP5 Antibody (3G10-1D5)

OIP5 Antibody (3G10-1D5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Analysis of OIP5 expression in transfected 293T cell line by OIP5 monoclonal antibody (M01), clone 3G10-1D5.Lane 1: OIP5 transfected lysate(24.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Analysis of OIP5 expression in transfected 293T cell line by OIP5 monoclonal antibody (M01), clone 3G10-1D5.Lane 1: OIP5 transfected lysate(24.7 KDa).Lane 2: ...read more
Immunoprecipitation: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Analysis of OIP5 transfected lysate using anti-OIP5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OIP5 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: OIP5 Antibody (3G10-1D5) [H00011339-M01] - Detection limit for recombinant GST tagged OIP5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
3G10-1D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

OIP5 Antibody (3G10-1D5) Summary

Immunogen
OIP5 (AAH15050, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Specificity
OIP5 - Opa interacting protein 5
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OIP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OIP5 Antibody (3G10-1D5)

  • Cancer/testis antigen 86
  • CT865730547N13Rik
  • hMIS18beta
  • LAP2alpha interactor-25
  • LINT-25
  • MIS18B
  • MIS18beta
  • OIP-5
  • Opa interacting protein 5
  • Opa-interacting protein 5
  • protein Mis18-beta

Background

Commonly referred to as OIP5, Opa interacting protein 5 is essential to protein binding. More specifically, OIP5 is necessary for the recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. OIP5 interacts with other proteins such as RAF1, BRAF, CENPA, CENPN, and HJURP and also binds UBC, TMPO, MIS18A, CASP10 and RARG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CENPA Antibody
NBP2-92632
Immunocytochemistry/Immunofluorescence: CENPA Antibody [NBP2-92632] - Analysis of U-2 OS cells using CENPA . Blue: DAPI for nuclear staining.
Western Blot: CENPA Antibody [NBP2-92632] - Analysis of extracts of various cell lines, using CENPA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
KNL-2 Antibody
H00055320-B01P
Immunocytochemistry/Immunofluorescence: KNL-2 Antibody [H00055320-B01P] - Analysis of purified antibody to C14orf106 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: KNL-2 Antibody [H00055320-B01P] - Analysis of C14orf106 expression in transfected 293T cell line by C14orf106 polyclonal antibody. Lane 1: C14orf106 transfected lysate(34.54 KDa). Lane 2: Non-transfected lysate.
Western Blot: KNL-2 Antibody [H00055320-B01P] - Analysis of C14orf106 expression in human spleen.
Species: Hu
Applications: ICC/IF, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Raf‑1 at approximately 75 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
CTAG1B Antibody
(OTI2B6)
NBP1-47714
Immunocytochemistry/Immunofluorescence: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Staining of 293T cells transfected by pCMV6-ENTRY CTAG1B(RC213318) using anti-CTAG1B antibody (green, upper left; DAPI/blue, lower left; merged, upper right). 293T cells transfected with empty vector served as a negative control (merged, lower right). (1:100)
Flow Cytometry: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Analysis of living 293T cells transfected with CTAG1B overexpression plasmid (RC213318), Red)/empty vector (Blue) using anti-CTAG1B antibody. Cells incubated with a non-specific antibody (Green) were used as isotype control. (1:100)
Flow Cytometry: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Analysis of living NCI-H1299 cells, using anti-CTAG1B antibody(red), compared to an isotype control (green).(1:100)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MIS18A Antibody
NBP1-88943
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. Sertoli cells are generally negative.
Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88943] - Staining in human testis and pancreas tissues using anti-MIS18A antibody. Corresponding MIS18A RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Cdc6 Antibody
NBP2-15837
Western Blot: Cdc6 Antibody [NBP2-15837] - Untreated (-) and treated (+) HeLa whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membranes were blotted with CDC6 antibody diluted at 1:500.
Western Blot: Cdc6 Antibody [NBP2-15837] - Whole cell extract (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with CDC6 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cdc6 Antibody [NBP2-15837] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDC6 protein stained by CDC6 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
RbAp46 Antibody
(OTI5A4)
NBP2-01308
Western Blot: RbAp46 Antibody (5A4) [NBP2-01308] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RbAp46 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RbAp46.
Immunohistochemistry-Paraffin: RbAp46 Antibody (5A4) [NBP2-01308] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-RbAp46 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: RbAp46 Antibody (5A4) [NBP2-01308] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-RbAp46 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Exonuclease 1
Antibody
NBP2-16391
Western Blot: Exonuclease 1 Antibody [NBP2-16391] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Exonuclease 1 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Exonuclease 1 Antibody [NBP2-16391] - Sample (50 ug of whole cell lysate) A: mouse thymus, 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Exonuclease 1 Antibody [NBP2-16391] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, WB
PIWIL2 Antibody
NBP2-24590
Immunohistochemistry-Paraffin: PIWIL2 Antibody [NBP2-24590] - Immunohistochemical analysis of PIWIL2 in formalin-fixed, paraffin-embedded mouse testis tissue using an isotype control (top left) and NBP2-24590 (bottom left, right) at 5 ug/ml.
Western Blot: PIWIL2 Antibody [NBP2-24590] - Analysis of Mili in mouse embryo testis lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Mu
Applications: IHC, IHC-P, WB
TAF7L Antibody
NBP1-84350
Immunocytochemistry/Immunofluorescence: TAF7L Antibody [NBP1-84350] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TAF7L Antibody [NBP1-84350] - Staining of human testis shows cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Aurora C Antibody
(OTI2B7)
NBP1-47663
Western Blot: Aurora C Antibody (2B7) [NBP1-47663] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Aurora C (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Aurora C.
Immunohistochemistry-Paraffin: Aurora C Antibody (2B7) [NBP1-47663] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-Aurora C mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Aurora C Antibody (2B7) [NBP1-47663] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-Aurora C mouse monoclonal antibody.
Species: Hu
Applications: IHC, IHC-P, WB
PCYT1A Antibody
NBP1-84366
Immunocytochemistry/Immunofluorescence: PCYT1A Antibody [NBP1-84366] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: PCYT1A Antibody [NBP1-84366] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: PCYT1A Antibody [NBP1-84366] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
OIP5 Antibody
(3G10-1D5)
H00011339-M01
OIP5 Antibody (3G10-1D5)
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for OIP5 Antibody (H00011339-M01) (0)

There are no publications for OIP5 Antibody (H00011339-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OIP5 Antibody (H00011339-M01) (0)

There are no reviews for OIP5 Antibody (H00011339-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OIP5 Antibody (H00011339-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OIP5 Products

Bioinformatics Tool for OIP5 Antibody (H00011339-M01)

Discover related pathways, diseases and genes to OIP5 Antibody (H00011339-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OIP5 Antibody (H00011339-M01)

Discover more about diseases related to OIP5 Antibody (H00011339-M01).
 

Pathways for OIP5 Antibody (H00011339-M01)

View related products by pathway.

PTMs for OIP5 Antibody (H00011339-M01)

Learn more about PTMs related to OIP5 Antibody (H00011339-M01).
 

Research Areas for OIP5 Antibody (H00011339-M01)

Find related products by research area.

Blogs on OIP5

There are no specific blogs for OIP5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OIP5 Antibody (3G10-1D5) and receive a gift card or discount.


Bioinformatics

Gene Symbol OIP5
Entrez
OMIM
Uniprot