ODR4/TTG1 Recombinant Protein Antigen

Images

 
There are currently no images for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ODR4/TTG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ODR4/TTG1.

Source: E.coli

Amino Acid Sequence: FCRTYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKSSRGNTQATSHCFDVRVLTQLLLNSDHRS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1ORF27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58718 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ODR4/TTG1 Recombinant Protein Antigen

  • chromosome 1 open reading frame 27
  • FLJ20505
  • hODR-4
  • LAG1-interacting protein
  • odorant response abnormal 4
  • ODR4
  • odr-4
  • protein odr-4 homolog
  • Transactivated by transforming growth factor beta protein 1
  • TTG1
  • TTG1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00005555-P01
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55534
Species: Hu
Applications: WB, ICC/IF
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP) (0)

There are no publications for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP) (0)

There are no reviews for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ODR4/TTG1 Products

Bioinformatics Tool for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP)

Discover related pathways, diseases and genes to ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP)

Discover more about diseases related to ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP).
 

Pathways for ODR4/TTG1 Recombinant Protein Antigen (NBP2-58718PEP)

View related products by pathway.

Blogs on ODR4/TTG1

There are no specific blogs for ODR4/TTG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Reg3A Antibody
NBP2-24763
Reg3A Antibody
NBP2-24763

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ODR4/TTG1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF27