ODF3L2 Antibody


Immunohistochemistry: ODF3L2 Antibody [NBP2-38113] - Staining of human kidney shows moderate cytoplasmic and nucleolar positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ODF3L2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
Specificity of human ODF3L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ODF3L2 Antibody

  • C19orf19
  • Chromosome 19 Open Reading Frame 19
  • Outer Dense Fiber Of Sperm Tails 3-Like 2
  • Outer Dense Fiber Protein 3-Like Protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ODF3L2 Antibody (NBP2-38113) (0)

There are no publications for ODF3L2 Antibody (NBP2-38113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF3L2 Antibody (NBP2-38113) (0)

There are no reviews for ODF3L2 Antibody (NBP2-38113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ODF3L2 Antibody (NBP2-38113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ODF3L2 Products

Bioinformatics Tool for ODF3L2 Antibody (NBP2-38113)

Discover related pathways, diseases and genes to ODF3L2 Antibody (NBP2-38113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ODF3L2

There are no specific blogs for ODF3L2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ODF3L2 Antibody and receive a gift card or discount.


Gene Symbol ODF3L2
Novus 100% Guarantee