OAZ2 Antibody

Images

 
Western Blot: OAZ2 Antibody [NBP1-70661] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OAZ2 Antibody Summary

Immunogen
Synthetic peptides corresponding to OAZ2(ornithine decarboxylase antizyme 2) The peptide sequence was selected from the middle region of OAZ2. Peptide sequence PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAZ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OAZ2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OAZ2 Antibody

  • AZ2
  • ODC-Az 2
  • ornithine decarboxylase antizyme 2

Background

Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56186
Species: Hu
Applications: ICC/IF
NBP1-90053
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82497
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57466
Species: Hu
Applications: ICC/IF
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-82750
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-70661
Species: Hu
Applications: WB

Publications for OAZ2 Antibody (NBP1-70661) (0)

There are no publications for OAZ2 Antibody (NBP1-70661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAZ2 Antibody (NBP1-70661) (0)

There are no reviews for OAZ2 Antibody (NBP1-70661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OAZ2 Antibody (NBP1-70661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OAZ2 Products

OAZ2 NBP1-70661

Bioinformatics Tool for OAZ2 Antibody (NBP1-70661)

Discover related pathways, diseases and genes to OAZ2 Antibody (NBP1-70661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OAZ2 Antibody (NBP1-70661)

Discover more about diseases related to OAZ2 Antibody (NBP1-70661).
 

Pathways for OAZ2 Antibody (NBP1-70661)

View related products by pathway.

Blogs on OAZ2

There are no specific blogs for OAZ2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OAZ2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OAZ2