Recombinant Human OASL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OASL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human OASL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKH

Protein/Peptide Type
Partial Recombinant Protein
Gene
OASL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OASL Protein

  • 2'-5'-oligoadenylate synthetase-like
  • p59 OASL
  • p59OASL59 kDa 2'-5'-oligoadenylate synthase-like protein
  • Thyroid receptor-interacting protein 14,59 kDa 2'-5'-oligoadenylate synthetase-like protein
  • TRIP-14
  • TRIP14TR-interacting protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5550
Species: Mu, Rt
Applications: WB
MAB1925
Species: Hu
Applications: IP, ICC
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004061-D01P
Species: Hu
Applications: WB
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for OASL Partial Recombinant Protein (H00008638-Q01) (0)

There are no publications for OASL Partial Recombinant Protein (H00008638-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OASL Partial Recombinant Protein (H00008638-Q01) (0)

There are no reviews for OASL Partial Recombinant Protein (H00008638-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OASL Partial Recombinant Protein (H00008638-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OASL Products

Bioinformatics Tool for OASL Partial Recombinant Protein (H00008638-Q01)

Discover related pathways, diseases and genes to OASL Partial Recombinant Protein (H00008638-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OASL Partial Recombinant Protein (H00008638-Q01)

Discover more about diseases related to OASL Partial Recombinant Protein (H00008638-Q01).
 

Pathways for OASL Partial Recombinant Protein (H00008638-Q01)

View related products by pathway.

PTMs for OASL Partial Recombinant Protein (H00008638-Q01)

Learn more about PTMs related to OASL Partial Recombinant Protein (H00008638-Q01).

Blogs on OASL

There are no specific blogs for OASL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OASL Antibody
NBP1-87363

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OASL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OASL