OAS1 Antibody - Azide and BSA Free

Western Blot: OAS1 Antibody [H00004938-D01P] - Analysis of OAS1 expression in MCF-7.

Western Blot: OAS1 Antibody [H00004938-D01P] - Western Blot analysis of OAS1 expression in transfected 293T cell line by OAS1 MaxPab rabbit polyclonal antibody. Lane 1: OAS1 transfected lysate (46.00 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OAS1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: OAS1 (NP_058132.2, 1 a.a. - 400 a.a.) full-length human protein. MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
• Specificity: OAS1 - 2',5'-oligoadenylate synthetase 1, 40/46kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OAS1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OAS1 Antibody - Azide and BSA Free

• (2-5')oligo(A) synthase 1,2'-5'-oligoadenylate synthetase 1,2-5A synthase 1,2'-5'-oligoisoadenylate synthetase 1
• (2-5')oligo(A) synthetase 1
• 2'-5'-oligo A synthetase 1
• 2'-5'-oligoadenylate synthase 1
• 2'-5'-oligoadenylate synthetase 1 (40-46 kD)
• 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• E18/E16,2-5A synthetase 1
• EC 2.7.7
• EC 2.7.7.-
• IFI-4,2'-5' oligoadenylate synthetase 1 p52 isoform
• OIAS2'-5' oligoadenylate synthetase 1 p48 isoform
• OIASI
• p46/p42 OAS

Background

This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OAS1
• Entrez:
  • 4938(Human)
• Uniprot:
  • NP_058132.2(Human)