OA1 Antibody

Images

 
Western Blot: OA1 Antibody [H00004935-B01P] - Analysis of GPR143 expression in transfected 293T cell line by GPR143 polyclonal antibody. Lane 1: GPR143 transfected lysate(46.64 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: OA1 Antibody [H00004935-B01P] - Analysis of negative control 293 cells (Black) and GPR143 expressing 293 cells (Green) using GPR143 purified mouse polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OA1 Antibody Summary

Immunogen
GPR143 (NP_000264.1, 1 a.a. - 424 a.a.) full-length human protein. MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Specificity
Reacts with G protein-coupled receptor 143.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GPR143
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Flow Cytometry
Application Notes
This antibody is reactive against transfected lysate in WB, FACS analysis and as a detection antibody in ELISA. It has been use for FACS.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OA1 Antibody

  • G protein-coupled receptor 143
  • G-protein coupled receptor 143
  • NYS6
  • OA1Ocular albinism type 1 protein
  • ocular albinism 1 (Nettleship-Falls)

Background

Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
H00004935-B01P
Species: Hu
Applications: WB, Flow

Publications for OA1 Antibody (H00004935-B01P) (0)

There are no publications for OA1 Antibody (H00004935-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OA1 Antibody (H00004935-B01P) (0)

There are no reviews for OA1 Antibody (H00004935-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OA1 Antibody (H00004935-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OA1 Products

Bioinformatics Tool for OA1 Antibody (H00004935-B01P)

Discover related pathways, diseases and genes to OA1 Antibody (H00004935-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OA1 Antibody (H00004935-B01P)

Discover more about diseases related to OA1 Antibody (H00004935-B01P).
 

Pathways for OA1 Antibody (H00004935-B01P)

View related products by pathway.

PTMs for OA1 Antibody (H00004935-B01P)

Learn more about PTMs related to OA1 Antibody (H00004935-B01P).
 

Research Areas for OA1 Antibody (H00004935-B01P)

Find related products by research area.

Blogs on OA1

There are no specific blogs for OA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR143
Entrez
Uniprot