NXF2 Antibody (4G1) - Azide and BSA Free

Western Blot: NXF2 Antibody (4G1) [H00056001-M08] - Western Blot analysis of NXF2 expression in HeLa ( Cat # L013V1 ).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NXF2 Antibody (4G1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NXF2 Antibody (4G1) - Azide and BSA Free (H00056001-M08) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NXF2 (AAH15020.1, 95 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DEIRITTWRNRKPPERKMSQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFV
• Specificity: NXF2 - nuclear RNA export factor 2 (4G1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NXF2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NXF2 Antibody (4G1) - Azide and BSA Free

• CT39TAPL-2Cancer/testis antigen 39
• FLJ20416
• nuclear RNA export factor 2
• NXF2B
• TAP like protein 2
• TAPL2
• TAP-like protein 2

Background

This gene is one of a family of nuclear RNA export factor genes. It encodes a protein that is involved in mRNA export, is located in the nucleoplasm, and is associated with the nuclear envelope. Alternative splicing seems to be a common mechanism in this gene family. Two variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NXF2
• Entrez:
  • 56001(Human)
• Uniprot:
  • AAH15020(Human)